Citrus Sinensis ID: 033223


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MSVLEQNFPVVQKKLSVDLKRNKTDIIICSYDDHFLVIATQIGTMGTILHARKDADISVHPTFSVSVIFGKRDEPMLVACARQLIEHISSSGTSQPLVLSLGLKDHSAETLKGIVSAVTENRLW
ccccccccccccEEEEEEEcccEEEEEEEEEccEEEEEEEEcccccEEEEEECccccccccccEEEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHcccc
*********VVQKKLSVDLKRNKTDIIICSYDDHFLVIATQIGTMGTILHARKDADISVHPTFSVSVIFGKRDEPMLVACARQLIEHISSSGTSQPLVLSLGLKDHSAETLKGIVSAVTENRLW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVLEQNFPVVQKKLSVDLKRNKTDIIICSYDDHFLVIATQIGTMGTILHARKDADISVHPTFSVSVIFGKRDEPMLVACARQLIEHISSSGTSQPLVLSLGLKDHSAETLKGIVSAVTENRLW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome assembly chaperone 3 Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with psmg1-psmg2 heterodimers to orchestrate the correct assembly of proteasomes.probableQ55G88

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z5E, chain A
Confidence level:very confident
Coverage over the Query: 4-124
View the alignment between query and template
View the model in PyMOL