Citrus Sinensis ID: 033234


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLKCCIL
ccccccccccEEEEEEEccccccccccEEEEEEEcccccccccccEEECcccccccccccccEECccccHHHHcccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccEEEc
*DDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMS*Q***LAQPPEGNEDARMDHKGLVLKCCIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLKCCIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 variant 1A Has no ubiquitin ligase activity on its own. The heterodimer with UBC catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. May play a role in the control of progress through the cell cycle and differentiation. Probably not involved in the error-free DNA repair.probableQ93YP0
Ubiquitin-conjugating enzyme spm2 Has a role in the DNA error-free postreplication repair (PRR) pathway. Lacks catalytic activity by itself. The ubc13/spm2 heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'.probableO74983
Probable ubiquitin-conjugating enzyme E2 variant Has no ubiquitin ligase activity on its own. The ube2v/ube2n heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.probableQ54D06

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HLW, chain A
Confidence level:very confident
Coverage over the Query: 3-106
View the alignment between query and template
View the model in PyMOL