Citrus Sinensis ID: 033234

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLKCCIL
ccccccccccEEEEEEEccccccccccEEEEEEEcccccccccccEEEEcccccccccccccEEEcccHHHHHcccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccEEEc
EcccccccccEEEEEEEccccccccccEEEEEEEccccccccccEEEEcEccccccEcccccEEcHHHcHHHHcccccccHHHHHHHHHHHHccHHHHccccccccccccccccccEEEEEEEc
mddaddilmqswtgtiigppntvhegrIYQLKlfcgtdypdnppsvrfqtrinmtcvnqetgmvepslfpmLANWQREYTMEDILTQLKKEmmspqnwklaqppegnedarmdhkglvlkccil
mddaddilmqswtgtiigppntvHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLKCCIL
MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLKCCIL
******ILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQL***************************GLVLKCCI*
*DDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMS*Q***LAQPPEGNEDARMDHKGLVLKCCIL
MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLKCCIL
****DDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPE*NEDARMDHKGLVLKCCIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLKCCIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query124 2.2.26 [Sep-21-2011]
Q93YP0158 Ubiquitin-conjugating enz yes no 0.991 0.778 0.758 3e-53
Q9CAB6159 Ubiquitin-conjugating enz no no 1.0 0.779 0.741 5e-53
Q9SVD7146 Ubiquitin-conjugating enz no no 0.854 0.726 0.745 3e-44
Q9SJ44145 Ubiquitin-conjugating enz no no 0.854 0.731 0.745 5e-44
Q54D06138 Probable ubiquitin-conjug yes no 0.854 0.768 0.528 2e-30
Q9D2M8145 Ubiquitin-conjugating enz yes no 0.854 0.731 0.518 1e-28
Q7M767145 Ubiquitin-conjugating enz yes no 0.854 0.731 0.509 2e-28
O74983139 Ubiquitin-conjugating enz yes no 0.862 0.769 0.523 6e-28
Q5R6C9145 Ubiquitin-conjugating enz yes no 0.854 0.731 0.509 6e-28
Q15819145 Ubiquitin-conjugating enz yes no 0.854 0.731 0.509 6e-28
>sp|Q93YP0|UEV1A_ARATH Ubiquitin-conjugating enzyme E2 variant 1A OS=Arabidopsis thaliana GN=UEV1A PE=1 SV=1 Back     alignment and function desciption
 Score =  206 bits (525), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 94/124 (75%), Positives = 109/124 (87%), Gaps = 1/124 (0%)

Query: 1   MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQE 60
           MDDADDI MQSWTGTI+GPPNT +EG+I+QLKLFCG +YP++PP+VRFQTRINM CVN E
Sbjct: 36  MDDADDIYMQSWTGTILGPPNTAYEGKIFQLKLFCGKEYPESPPTVRFQTRINMACVNPE 95

Query: 61  TGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLK 120
           TG+VEPSLFPML NW+REYTMEDIL +LKKEMM+  N KLAQPPEGNE+AR D KG   K
Sbjct: 96  TGVVEPSLFPMLTNWRREYTMEDILVKLKKEMMTSHNRKLAQPPEGNEEARADPKGPA-K 154

Query: 121 CCIL 124
           CC++
Sbjct: 155 CCVM 158
Has no ubiquitin ligase activity on its own. The heterodimer with UBC catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. May play a role in the control of progress through the cell cycle and differentiation. Probably not involved in the error-free DNA repair.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9CAB6|UEV1B_ARATH Ubiquitin-conjugating enzyme E2 variant 1B OS=Arabidopsis thaliana GN=UEV1B PE=1 SV=1 Back     alignment and function description
>sp|Q9SVD7|UEV1D_ARATH Ubiquitin-conjugating enzyme E2 variant 1D OS=Arabidopsis thaliana GN=UEV1D PE=1 SV=1 Back     alignment and function description
>sp|Q9SJ44|UEV1C_ARATH Ubiquitin-conjugating enzyme E2 variant 1C OS=Arabidopsis thaliana GN=UEV1C PE=1 SV=1 Back     alignment and function description
>sp|Q54D06|UBE2V_DICDI Probable ubiquitin-conjugating enzyme E2 variant OS=Dictyostelium discoideum GN=ube2v PE=3 SV=1 Back     alignment and function description
>sp|Q9D2M8|UB2V2_MOUSE Ubiquitin-conjugating enzyme E2 variant 2 OS=Mus musculus GN=Ube2v2 PE=2 SV=4 Back     alignment and function description
>sp|Q7M767|UB2V2_RAT Ubiquitin-conjugating enzyme E2 variant 2 OS=Rattus norvegicus GN=Ube2v2 PE=1 SV=3 Back     alignment and function description
>sp|O74983|MMS2_SCHPO Ubiquitin-conjugating enzyme spm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm2 PE=1 SV=1 Back     alignment and function description
>sp|Q5R6C9|UB2V2_PONAB Ubiquitin-conjugating enzyme E2 variant 2 OS=Pongo abelii GN=UBE2V2 PE=2 SV=1 Back     alignment and function description
>sp|Q15819|UB2V2_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens GN=UBE2V2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
225424357159 PREDICTED: ubiquitin-conjugating enzyme 1.0 0.779 0.911 2e-62
449466255 678 PREDICTED: uncharacterized protein LOC10 1.0 0.182 0.870 1e-61
224108293159 predicted protein [Populus trichocarpa] 1.0 0.779 0.895 2e-61
224101877159 predicted protein [Populus trichocarpa] 1.0 0.779 0.895 9e-61
357521263159 Ubiquitin-conjugating enzyme E2 variant 1.0 0.779 0.862 7e-60
359811351159 uncharacterized protein LOC100820440 [Gl 1.0 0.779 0.879 9e-60
71040677159 ubiquitin-conjugating enzyme 2 [Arachis 1.0 0.779 0.879 9e-60
351722538159 uncharacterized protein LOC100527089 [Gl 1.0 0.779 0.862 2e-59
356530782159 PREDICTED: ubiquitin-conjugating enzyme 1.0 0.779 0.846 4e-59
255628519159 unknown [Glycine max] 1.0 0.779 0.846 1e-58
>gi|225424357|ref|XP_002284969.1| PREDICTED: ubiquitin-conjugating enzyme E2 variant 1A [Vitis vinifera] gi|147806487|emb|CAN63218.1| hypothetical protein VITISV_026897 [Vitis vinifera] gi|297737640|emb|CBI26841.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 119/124 (95%)

Query: 1   MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQE 60
           MDDADDI MQSWTGTIIGPPNTVHEGRIYQLKLFCG DYPDNPP+V+FQTRINMTCVNQE
Sbjct: 36  MDDADDIYMQSWTGTIIGPPNTVHEGRIYQLKLFCGQDYPDNPPTVKFQTRINMTCVNQE 95

Query: 61  TGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLK 120
           TG+VEPSLFPMLA WQRE+TMEDILTQLKKEMMSPQN KLAQPPEGNE+AR+D KGLVLK
Sbjct: 96  TGVVEPSLFPMLATWQREHTMEDILTQLKKEMMSPQNRKLAQPPEGNEEARIDQKGLVLK 155

Query: 121 CCIL 124
           CCIL
Sbjct: 156 CCIL 159

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449466255|ref|XP_004150842.1| PREDICTED: uncharacterized protein LOC101209154 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224108293|ref|XP_002314791.1| predicted protein [Populus trichocarpa] gi|222863831|gb|EEF00962.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224101877|ref|XP_002312456.1| predicted protein [Populus trichocarpa] gi|222852276|gb|EEE89823.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357521263|ref|XP_003630920.1| Ubiquitin-conjugating enzyme E2 variant 1B [Medicago truncatula] gi|355524942|gb|AET05396.1| Ubiquitin-conjugating enzyme E2 variant 1B [Medicago truncatula] gi|388495378|gb|AFK35755.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|359811351|ref|NP_001241424.1| uncharacterized protein LOC100820440 [Glycine max] gi|255646858|gb|ACU23900.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|71040677|gb|AAZ20287.1| ubiquitin-conjugating enzyme 2 [Arachis hypogaea] Back     alignment and taxonomy information
>gi|351722538|ref|NP_001238527.1| uncharacterized protein LOC100527089 [Glycine max] gi|255631530|gb|ACU16132.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356530782|ref|XP_003533959.1| PREDICTED: ubiquitin-conjugating enzyme E2 variant 1A-like [Glycine max] Back     alignment and taxonomy information
>gi|255628519|gb|ACU14604.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
TAIR|locus:2028085158 MMZ1 "AT1G23260" [Arabidopsis 0.991 0.778 0.758 1.3e-50
TAIR|locus:2033561159 MMZ2 "AT1G70660" [Arabidopsis 1.0 0.779 0.741 5.8e-50
ASPGD|ASPL0000013615141 AN3644 [Emericella nidulans (t 0.846 0.744 0.504 2.3e-30
DICTYBASE|DDB_G0292596138 ube2v "putative ubiquitin-conj 0.854 0.768 0.528 1.6e-29
MGI|MGI:1917870145 Ube2v2 "ubiquitin-conjugating 0.854 0.731 0.518 1e-27
RGD|727838145 Ube2v2 "ubiquitin-conjugating 0.854 0.731 0.509 1.3e-27
UNIPROTKB|Q7M767145 Ube2v2 "Ubiquitin-conjugating 0.854 0.731 0.509 1.3e-27
UNIPROTKB|I3L6T2144 UBE2V2 "Uncharacterized protei 0.854 0.736 0.509 1.7e-27
UNIPROTKB|Q3SZ43145 UBE2V2 "Ubiquitin-conjugating 0.854 0.731 0.509 2.2e-27
UNIPROTKB|J9NY44145 UBE2V2 "Uncharacterized protei 0.854 0.731 0.509 2.2e-27
TAIR|locus:2028085 MMZ1 "AT1G23260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 526 (190.2 bits), Expect = 1.3e-50, P = 1.3e-50
 Identities = 94/124 (75%), Positives = 109/124 (87%)

Query:     1 MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQE 60
             MDDADDI MQSWTGTI+GPPNT +EG+I+QLKLFCG +YP++PP+VRFQTRINM CVN E
Sbjct:    36 MDDADDIYMQSWTGTILGPPNTAYEGKIFQLKLFCGKEYPESPPTVRFQTRINMACVNPE 95

Query:    61 TGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHKGLVLK 120
             TG+VEPSLFPML NW+REYTMEDIL +LKKEMM+  N KLAQPPEGNE+AR D KG   K
Sbjct:    96 TGVVEPSLFPMLTNWRREYTMEDILVKLKKEMMTSHNRKLAQPPEGNEEARADPKGPA-K 154

Query:   121 CCIL 124
             CC++
Sbjct:   155 CCVM 158
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0006301 "postreplication repair" evidence=IGI;RCA
GO:0031372 "UBC13-MMS2 complex" evidence=IPI
GO:0006623 "protein targeting to vacuole" evidence=RCA
TAIR|locus:2033561 MMZ2 "AT1G70660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000013615 AN3644 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292596 ube2v "putative ubiquitin-conjugating enzyme E2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1917870 Ube2v2 "ubiquitin-conjugating enzyme E2 variant 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|727838 Ube2v2 "ubiquitin-conjugating enzyme E2 variant 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q7M767 Ube2v2 "Ubiquitin-conjugating enzyme E2 variant 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6T2 UBE2V2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ43 UBE2V2 "Ubiquitin-conjugating enzyme E2 variant 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NY44 UBE2V2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O74983MMS2_SCHPONo assigned EC number0.52330.86290.7697yesno
Q54D06UBE2V_DICDINo assigned EC number0.52830.85480.7681yesno
Q9D2M8UB2V2_MOUSENo assigned EC number0.51880.85480.7310yesno
Q93YP0UEV1A_ARATHNo assigned EC number0.75800.99190.7784yesno
Q5R6C9UB2V2_PONABNo assigned EC number0.50940.85480.7310yesno
Q15819UB2V2_HUMANNo assigned EC number0.50940.85480.7310yesno
Q7M767UB2V2_RATNo assigned EC number0.50940.85480.7310yesno
P53152MMS2_YEASTNo assigned EC number0.52830.84670.7664yesno
Q3SZ43UB2V2_BOVINNo assigned EC number0.50940.85480.7310yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2.19LOW CONFIDENCE prediction!
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00101010
hypothetical protein (159 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 2e-21
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 5e-21
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 3e-11
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 1e-10
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 2e-06
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 2e-05
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information 
 Score = 82.7 bits (205), Expect = 2e-21
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 5/112 (4%)

Query: 5   DDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMV 64
           DD  +  WTGTI+GPP T +EG +++L +    DYP  PP V+F T+I    V+  +G +
Sbjct: 23  DDENLLEWTGTIVGPPGTPYEGGVFKLTIEFPEDYPFKPPKVKFITKIYHPNVD-SSGEI 81

Query: 65  E-PSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDARMDHK 115
               L      W    T+E +L  L + ++S  N       +  E  + + +
Sbjct: 82  CLDILKQ--EKWSPALTLETVLLSL-QSLLSEPNPDSPLNADAAELYKKNRE 130

Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. This pathway functions in regulating many fundamental processes required for cell viability.TSG101 is one of several UBC homologues that lacks this active site cysteine. Length = 145
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 124
KOG0417148 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 100.0
KOG0419152 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0425171 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 100.0
PLN00172147 ubiquitin conjugating enzyme; Provisional 100.0
KOG0424158 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0421175 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 100.0
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.97
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.97
KOG0422153 consensus Ubiquitin-protein ligase [Posttranslatio 99.97
KOG0426165 consensus Ubiquitin-protein ligase [Posttranslatio 99.97
KOG0416189 consensus Ubiquitin-protein ligase [Posttranslatio 99.97
KOG0420184 consensus Ubiquitin-protein ligase [Posttranslatio 99.95
KOG0423223 consensus Ubiquitin-protein ligase [Posttranslatio 99.92
KOG0427161 consensus Ubiquitin conjugating enzyme [Posttransl 99.91
KOG0894244 consensus Ubiquitin-protein ligase [Posttranslatio 99.89
KOG0896138 consensus Ubiquitin-conjugating enzyme E2 [Posttra 99.8
KOG0428 314 consensus Non-canonical ubiquitin conjugating enzy 99.79
KOG08951101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.61
KOG0429258 consensus Ubiquitin-conjugating enzyme-related pro 99.55
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.36
KOG0897122 consensus Predicted ubiquitin-conjugating enzyme [ 98.76
PF14461133 Prok-E2_B: Prokaryotic E2 family B 98.37
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 98.26
KOG2391 365 consensus Vacuolar sorting protein/ubiquitin recep 97.3
PF14457162 Prok-E2_A: Prokaryotic E2 family A 95.72
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 94.49
PF14462122 Prok-E2_E: Prokaryotic E2 family E 93.58
smart00591107 RWD domain in RING finger and WD repeat containing 93.51
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 93.06
>KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-41  Score=236.84  Aligned_cols=102  Identities=25%  Similarity=0.515  Sum_probs=99.0

Q ss_pred             CCCCCccceEEEEEECCCCCCCCCCEEEEEEEeCCCCCCCCCCceeeeecccCCccCCCCeeeccCCCCCCCCCCCCCHH
Q 033234            3 DADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTME   82 (124)
Q Consensus         3 ~~dd~~l~~W~~~i~Gp~~tpyegg~f~~~i~fp~~yP~~pP~v~f~t~i~Hpnv~~~~G~icl~~l~~~~~W~p~~~l~   82 (124)
                      ++||++  +|+++|.||.|||||||+|++.|.||++||++||+|+|.|+||||||+. +|.||+++|  +++|+|+++++
T Consensus        26 ~~dnl~--~w~a~I~GP~~SpYEgG~F~l~I~~p~~YP~~PPkV~F~TkIyHPNI~~-~G~IclDIL--k~~WsPAl~i~  100 (148)
T KOG0417|consen   26 VGDNLF--HWQATILGPPGSPYEGGVFFLEIHFPEDYPFKPPKVRFLTKIYHPNIDS-NGRICLDIL--KDQWSPALTIS  100 (148)
T ss_pred             CCCcee--eEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCceEeecccccCCcCc-cccchHHhh--hccCChhhHHH
Confidence            578999  9999999999999999999999999999999999999999999999995 999999999  58899999999


Q ss_pred             HHHHHHHHHhcCCCCCCCCCCccCccc
Q 033234           83 DILTQLKKEMMSPQNWKLAQPPEGNED  109 (124)
Q Consensus        83 ~il~~i~~~l~~P~~~~~~~~~~~~~~  109 (124)
                      +||++|+++|.+|+++++..++++..|
T Consensus       101 ~VllsI~sLL~~PnpddPL~~~ia~~~  127 (148)
T KOG0417|consen  101 KVLLSICSLLSDPNPDDPLVPDIAELY  127 (148)
T ss_pred             HHHHHHHHHhcCCCCCccccHHHHHHH
Confidence            999999999999999999999999988

>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0897 consensus Predicted ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14457 Prok-E2_A: Prokaryotic E2 family A Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>PF14462 Prok-E2_E: Prokaryotic E2 family E Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
1j74_A145 Crystal Structure Of Mms2 Length = 145 5e-29
4epo_A149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 6e-29
1zgu_A139 Solution Structure Of The Human Mms2-Ubiquitin Comp 7e-29
3von_B138 Crystalstructure Of The Ubiquitin Protease Length = 7e-29
2hlw_A170 Solution Structure Of The Human Ubiquitin-Conjugati 1e-28
2a4d_A160 Structure Of The Human Ubiquitin-Conjugating Enzyme 1e-28
1jat_B138 Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng 3e-28
2gmi_B137 Mms2UBC13~UBIQUITIN Length = 137 3e-28
2c2v_C142 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 3e-28
2q0v_A156 Crystal Structure Of Ubiquitin Conjugating Enzyme E 2e-25
3e95_C158 Crystal Structure Of The Plasmodium Falciparum Ubiq 2e-25
1y6l_A149 Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 1e-07
3bzh_A194 Crystal Structure Of Human Ubiquitin-Conjugating En 5e-07
4auq_A147 Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 7e-07
2e2c_A156 E2-C, An Ubiquitin Conjugating Enzyme Required For 8e-07
1z2u_A150 The 1.1a Crystallographic Structure Of Ubiquitin- C 9e-07
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 1e-06
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 1e-06
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 1e-06
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-06
4ddg_A 399 Crystal Structure Of Human Otub1UBCH5B~UBUB Length 2e-06
2pwq_A216 Crystal Structure Of A Putative Ubiquitin Conjugati 2e-06
2bep_A159 Crystal Structure Of Ubiquitin Conjugating Enzyme E 2e-06
3e46_A253 Crystal Structure Of Ubiquitin-Conjugating Enzyme E 2e-06
3a33_A150 Ubch5b~ubiquitin Conjugate Length = 150 2e-06
1yla_A202 Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington 2e-06
3ugb_A147 Ubch5c~ubiquitin Conjugate Length = 147 2e-06
3k9o_A201 The Crystal Structure Of E2-25k And Ubb+1 Complex L 2e-06
3k9p_A217 The Crystal Structure Of E2-25k And Ubiquitin Compl 2e-06
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 3e-06
4ii2_C163 Crystal Structure Of Ubiquitin Activating Enzyme 1 4e-06
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 5e-06
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 5e-06
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 5e-06
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 5e-06
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 6e-06
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 6e-06
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 6e-06
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 6e-06
2c4o_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 6e-06
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 6e-06
1x23_A155 Crystal Structure Of Ubch5c Length = 155 6e-06
3jvz_A146 E2~ubiquitin-Hect Length = 146 6e-06
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 6e-06
2ob4_A180 Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 8e-06
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 8e-06
3rz3_A183 Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len 8e-06
2f4z_A193 Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw 8e-06
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 1e-05
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 1e-05
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 1e-05
2eso_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 2e-05
1fxt_A149 Structure Of A Conjugating Enzyme-Ubiquitin Thioles 3e-05
1pzv_A164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 4e-05
1tte_A215 The Structure Of A Class Ii Ubiquitin-Conjugating E 5e-05
4fh1_A153 S. Cerevisiae Ubc13-N79a Length = 153 5e-05
1qcq_A148 Ubiquitin Conjugating Enzyme Length = 148 1e-04
2gmi_A152 Mms2UBC13~UBIQUITIN Length = 152 1e-04
4gpr_A151 Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin 2e-04
1i7k_A179 Crystal Structure Of Human Mitotic-Specific Ubiquit 4e-04
1jas_A152 Hsubc2b Length = 152 4e-04
3e95_A151 Crystal Structure Of The Plasmodium Falciparum Ubiq 5e-04
2r0j_A149 Crystal Structure Of The Putative Ubiquitin Conjuga 5e-04
1jat_A155 Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng 6e-04
1jbb_A153 Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 6e-04
4ds2_A167 Ubiquitin Conjugating Enzyme (Putative) From Trypan 6e-04
1yrv_A169 Novel Ubiquitin-Conjugating Enzyme Length = 169 7e-04
1zdn_A158 Ubiquitin-Conjugating Enzyme E2s Length = 158 7e-04
>pdb|1J74|A Chain A, Crystal Structure Of Mms2 Length = 145 Back     alignment and structure 
Iteration: 1

 Score =  122 bits (306), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 54/106 (50%), Positives = 75/106 (70%)
Query: 1   MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQE 60
           ++D +D+ +  WTG IIGPP T +E RIY LK+ CG  YP+ PPSVRF T+INM  +N  
Sbjct: 35  LEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNS 94
Query: 61  TGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEG 106
           +GMV+    P+LA WQ  Y+++ +L +L++ MMS +N KL QPPEG
Sbjct: 95  SGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG 140
>pdb|4EPO|A Chain A, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure
>pdb|1ZGU|A Chain A, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 139 Back     alignment and structure
>pdb|3VON|B Chain B, Crystalstructure Of The Ubiquitin Protease Length = 138 Back     alignment and structure
>pdb|2HLW|A Chain A, Solution Structure Of The Human Ubiquitin-Conjugating Enzyme Variant Uev1a Length = 170 Back     alignment and structure
>pdb|2A4D|A Chain A, Structure Of The Human Ubiquitin-Conjugating Enzyme E2 Variant 1 (Uev- 1) Length = 160 Back     alignment and structure
>pdb|1JAT|B Chain B, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 138 Back     alignment and structure
>pdb|2GMI|B Chain B, Mms2UBC13~UBIQUITIN Length = 137 Back     alignment and structure
>pdb|2C2V|C Chain C, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 142 Back     alignment and structure
>pdb|2Q0V|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2, Putative, From Plasmodium Falciparum Length = 156 Back     alignment and structure
>pdb|3E95|C Chain C, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 158 Back     alignment and structure
>pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 Back     alignment and structure
>pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 Back     alignment and structure
>pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 Back     alignment and structure
>pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 Back     alignment and structure
>pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 Back     alignment and structure
>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 Back     alignment and structure
>pdb|2BEP|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2-25k Length = 159 Back     alignment and structure
>pdb|3E46|A Chain A, Crystal Structure Of Ubiquitin-Conjugating Enzyme E2-25kda (Huntington Interacting Protein 2) M172a Mutant Length = 253 Back     alignment and structure
>pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 Back     alignment and structure
>pdb|1YLA|A Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington Interacting Protein 2) Length = 202 Back     alignment and structure
>pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 Back     alignment and structure
>pdb|3K9O|A Chain A, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 201 Back     alignment and structure
>pdb|3K9P|A Chain A, The Crystal Structure Of E2-25k And Ubiquitin Complex Length = 217 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 Back     alignment and structure
>pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 Back     alignment and structure
>pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 Back     alignment and structure
>pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 Back     alignment and structure
>pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 Back     alignment and structure
>pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 Back     alignment and structure
>pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 Back     alignment and structure
>pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin- Conjugating Enzyme, Ubch10 Length = 179 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 Back     alignment and structure
>pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 Back     alignment and structure
>pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 Back     alignment and structure
>pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 Back     alignment and structure
>pdb|4DS2|A Chain A, Ubiquitin Conjugating Enzyme (Putative) From Trypanosoma Cruzi Length = 167 Back     alignment and structure
>pdb|1YRV|A Chain A, Novel Ubiquitin-Conjugating Enzyme Length = 169 Back     alignment and structure
>pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 1e-44
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 2e-44
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 2e-43
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 1e-42
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 9e-14
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 2e-13
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 2e-13
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 2e-13
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 3e-13
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 3e-13
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 3e-13
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 4e-13
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 4e-13
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 5e-13
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 5e-13
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 5e-13
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 5e-13
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 6e-13
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 6e-13
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 6e-13
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 8e-13
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 9e-13
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 9e-13
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 1e-12
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 1e-12
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 1e-12
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 1e-12
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 1e-12
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 1e-12
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 2e-12
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 4e-12
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 9e-12
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 1e-11
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 1e-11
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 1e-11
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 2e-11
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 2e-11
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 4e-11
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 4e-11
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 6e-11
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 6e-11
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 7e-11
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 8e-11
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 1e-10
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 2e-10
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 7e-10
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 8e-10
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 1e-09
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 3e-09
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 6e-07
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
 Score =  141 bits (358), Expect = 1e-44
 Identities = 53/106 (50%), Positives = 74/106 (69%)

Query: 1   MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQE 60
           ++D +D+ +  WTG IIGPP T++E RIY LK+ CG  YP+ PP VRF T+INM  VN  
Sbjct: 50  LEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSS 109

Query: 61  TGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEG 106
            G+V+P    +LA WQ  Y+++ +L +L++ MMS +N KL QPPEG
Sbjct: 110 NGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG 155
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 100.0
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 100.0
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 100.0
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 100.0
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 100.0
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 100.0
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 100.0
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 100.0
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 100.0
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 100.0
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 100.0
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 100.0
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 100.0
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 100.0
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 100.0
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 100.0
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 100.0
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 100.0
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 100.0
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 100.0
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 100.0
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 100.0
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 100.0
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 100.0
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 100.0
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 100.0
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 100.0
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 100.0
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 100.0
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 100.0
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 100.0
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 100.0
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 100.0
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 100.0
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 100.0
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 100.0
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 100.0
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 100.0
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 100.0
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 100.0
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 100.0
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 100.0
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 100.0
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 100.0
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 100.0
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 100.0
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 100.0
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.98
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 99.97
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.96
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.96
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.88
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 99.78
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 99.62
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 99.5
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 94.41
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 93.41
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 93.08
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 92.53
3zqs_A186 E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A 92.08
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 89.82
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 87.66
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 84.8
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
Probab=100.00  E-value=4.9e-38  Score=225.86  Aligned_cols=105  Identities=30%  Similarity=0.475  Sum_probs=85.2

Q ss_pred             CCCCCccceEEEEEECCCCCCCCCCEEEEEEEeCCCCCCCCCCceeeeecccCCccCCCCeeeccCCCC-----------
Q 033234            3 DADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPM-----------   71 (124)
Q Consensus         3 ~~dd~~l~~W~~~i~Gp~~tpyegg~f~~~i~fp~~yP~~pP~v~f~t~i~Hpnv~~~~G~icl~~l~~-----------   71 (124)
                      +++|++  +|+++|.||++||||||+|+++|.||++||++||+|+|.|+||||||+. +|+||+++|..           
T Consensus        43 ~~~nl~--~W~~~I~GP~~TpYegG~f~~~i~fp~~YP~~PP~v~F~T~i~HPNV~~-~G~IClsiL~~~~~d~~~~~~~  119 (172)
T 2awf_A           43 DDNDLY--RWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDK-NGDVCISILHEPGEDKYGYEKP  119 (172)
T ss_dssp             STTCTT--EEEEEEECCTTSTTTTCEEEEEEECCTTTTSSCCEEEECSCCCCTTBCT-TCBBCCGGGSCC---------C
T ss_pred             CCcccc--ccEEEEeCCCCCCcCCcEEEEEEECCcccCCCCCcccccCCCccCCCCC-CCcEehhhcCCccccccccccc
Confidence            557888  9999999999999999999999999999999999999999999999997 89999999951           


Q ss_pred             CCCCCCCCCHHHHHHHHHHHhcCCCCCCCCCCccCcccc
Q 033234           72 LANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEGNEDA  110 (124)
Q Consensus        72 ~~~W~p~~~l~~il~~i~~~l~~P~~~~~~~~~~~~~~~  110 (124)
                      .+.|+|+++|++||++|+++|.+|++++++|.+|+..|.
T Consensus       120 ~~~WsP~~ti~~vL~sI~sll~~Pn~~~p~n~~aa~~~~  158 (172)
T 2awf_A          120 EERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWR  158 (172)
T ss_dssp             TTSCCTTCCHHHHHHHHHHHHSCC---------------
T ss_pred             CCCCCCcCcHHHHHHHHHHHHHCcCCCCccCHHHHHHHH
Confidence            268999999999999999999999999999999999984
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 124
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 4e-34
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 1e-30
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 2e-15
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 4e-12
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 1e-10
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 1e-10
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 1e-10
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 3e-10
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-09
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 2e-09
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 2e-09
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 3e-09
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 3e-09
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 3e-09
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 2e-08
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 3e-08
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 3e-08
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-07
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 1e-07
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 2e-07
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 3e-07
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 3e-07
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 6e-07
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 8e-07
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 1e-05
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 1e-05
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 5e-04
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 variant 1 [TaxId: 9606]

 Score =  113 bits (283), Expect = 4e-34
 Identities = 53/106 (50%), Positives = 74/106 (69%)

Query: 1   MDDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQE 60
           ++D +D+ +  WTG IIGPP T++E RIY LK+ CG  YP+ PP VRF T+INM  VN  
Sbjct: 30  LEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSS 89

Query: 61  TGMVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNWKLAQPPEG 106
            G+V+P    +LA WQ  Y+++ +L +L++ MMS +N KL QPPEG
Sbjct: 90  NGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG 135
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 100.0
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 100.0
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 100.0
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 100.0
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 100.0
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 100.0
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 100.0
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 100.0
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.96
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.96
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.77
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 99.68
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 91.92
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 91.34
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 86.94
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 85.8
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 84.23
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]

Probab=100.00  E-value=2.2e-38  Score=218.47  Aligned_cols=107  Identities=51%  Similarity=0.986  Sum_probs=100.3

Q ss_pred             CCCCCCccceEEEEEECCCCCCCCCCEEEEEEEeCCCCCCCCCCceeeeecccCCccCCCCeeeccCCCCCCCCCCCCCH
Q 033234            2 DDADDILMQSWTGTIIGPPNTVHEGRIYQLKLFCGTDYPDNPPSVRFQTRINMTCVNQETGMVEPSLFPMLANWQREYTM   81 (124)
Q Consensus         2 ~~~dd~~l~~W~~~i~Gp~~tpyegg~f~~~i~fp~~yP~~pP~v~f~t~i~Hpnv~~~~G~icl~~l~~~~~W~p~~~l   81 (124)
                      .++||.++++|+++|.||++|||+||+|+++|.||++||++||+|+|.|+++||||+.++|.+|++++. .++|+|++||
T Consensus        30 ~~~dd~~l~~W~~~i~Gp~~tpy~gg~f~~~i~fp~~YP~~PP~v~f~t~i~HpnV~~~~G~icl~~l~-~~~Wsp~~ti  108 (136)
T d1jatb_          30 ADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHT-LRDWKRAYTM  108 (136)
T ss_dssp             SSTTCTTCCEEEEEEECCSSSTTTTCEEEEEEECCTTTTTSCCEEEESBCCCCTTBCTTTCBBCTTSHH-HHTCCTTCCH
T ss_pred             cCCCCCceeEEEEEEECCCCChhhcCEEEEEEEecCCCCCCCCEEEEeccccccccccCCCeEECCCCc-ccCcCccCcH
Confidence            456676666999999999999999999999999999999999999999999999999878999999874 5789999999


Q ss_pred             HHHHHHHHHHhcCCCCCCCCCCccCccc
Q 033234           82 EDILTQLKKEMMSPQNWKLAQPPEGNED  109 (124)
Q Consensus        82 ~~il~~i~~~l~~P~~~~~~~~~~~~~~  109 (124)
                      .+||++|+++|.+|++.+++|+++++.|
T Consensus       109 ~~IL~~i~~lL~~P~n~~~~q~~~g~~y  136 (136)
T d1jatb_         109 ETLLLDLRKEMATPANKKLRQPKEGETF  136 (136)
T ss_dssp             HHHHHHHHHHHTSHHHHTSCCCCTTCBC
T ss_pred             HHHHHHHHHHHcCCCCCCCCCCCCCCcC
Confidence            9999999999999999999999999887
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure