Citrus Sinensis ID: 033246

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MHQRKAEMARNSDCFIALPGGYGTLEELLEVITWAQLGIHDKPVGLINVDGYYNSLLNFIDKAVDDGFISPSQRSILVSAPNAKELVQKLEEYVPLHDGVVAKVKWEAEQVELNTSLKTEIAR
ccHHHHHHHHHccCEEEcccccccHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHcccccccccccEEEcccHHHHHHHHHHccccccccccccccHHHHHHHcccccccccc
*********RNSDCFIALPGGYGTLEELLEVITWAQLGIHDKPVGLINVDGYYNSLLNFIDKAVDDGFISPSQRSILVSAPNAKELVQKLEEYVPLHDGVVAKVKWEAEQV************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHQRKAEMARNSDCFIALPGGYGTLEELLEVITWAQLGIHDKPVGLINVDGYYNSLLNFIDKAVDDGFISPSQRSILVSAPNAKELVQKLEEYVPLHDGVVAKVKWEAEQVELNTSLKTEIAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase LOGL2 Cytokinin-activating enzyme working in the direct activation pathway. Phosphoribohydrolase that converts inactive cytokinin nucleotides to the biologically active free-base forms.probableB9F166
Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase LOGL3 Cytokinin-activating enzyme working in the direct activation pathway. Phosphoribohydrolase that converts inactive cytokinin nucleotides to the biologically active free-base forms.probableQ8H7U8
Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG5 Cytokinin-activating enzyme working in the direct activation pathway. Phosphoribohydrolase that converts inactive cytokinin nucleotides to the biologically active free-base forms.probableQ8LBB7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A33, chain A
Confidence level:very confident
Coverage over the Query: 2-92
View the alignment between query and template
View the model in PyMOL