Citrus Sinensis ID: 033290


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MGACFVFVLKLVVLYVDFKLDESYTPSKISVRAGDGFHNLKEIKTVELVKPTGWVYISLSGNDPRDTFVNTFMLQIVVLSNHLNGRDTHVRQIKIYGPRPNPIPHQQFQFTSSEFITYSTVR
cccEEEEEEEEEEEEEEccccccccccEEEEEEcccccccEEEEEEECcccccEEEEECccccccccCEEEEEEEEEEEcccccccccEEEEEEEEccccccccccccccccHHHHHHHccc
**ACFVFVLKLVVLYVDFKLDESYTPSKISVRAGDGFHNLKEIKTVELVKPTGWVYISLSGNDPRDTFVNTFMLQIVVLSNHLNGRDTHVRQIKIYGPRPNPIPHQQFQFTSSEFITYSTVR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGACFVFVLKLVVLYVDFKLDESYTPSKISVRAGDGFHNLKEIKTVELVKPTGWVYISLSGNDPRDTFVNTFMLQIVVLSNHLNGRDTHVRQIKIYGPRPNPIPHQQFQFTSSEFITYSTVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Anaphase-promoting complex subunit 10 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.probableQ9UM13
Anaphase-promoting complex subunit 10 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.probableQ8K2H6
Anaphase-promoting complex subunit 10 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating the ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several other aspects of development. Involved in the control of endoreduplication.probableQ9ZPW2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JHJ, chain A
Confidence level:very confident
Coverage over the Query: 6-99
View the alignment between query and template
View the model in PyMOL
Template: 1GQP, chain A
Confidence level:very confident
Coverage over the Query: 6-99
View the alignment between query and template
View the model in PyMOL