Citrus Sinensis ID: 033318

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MNSRRDYRNSKVALFDGIEEGGIRASSSYSHEIDEHDNERALEGLQDRVNLLKRLSGDINEEVDTHNRMLERMGNDMDASRGVLSGTMDKFKMVFETKSSRRMFTLVASFVVIFLIVYYLTR
cccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc
*************************************************NLLKRLSGDINEEVDTHNRMLERMGNDM**********MDKFKMVFETKSSRRMFTLVASFVVIFLIVYYLTR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSRRDYRNSKVALFDGIEEGGIRASSSYSHEIDEHDNERALEGLQDRVNLLKRLSGDINEEVDTHNRMLERMGNDMDASRGVLSGTMDKFKMVFETKSSRRMFTLVASFVVIFLIVYYLTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bet1-like SNARE 1-1 Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE associated with ER-derived vesicles.confidentQ9M2J9
BET1-like protein Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex.probableO35153

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NPS, chain D
Confidence level:very confident
Coverage over the Query: 39-101
View the alignment between query and template
View the model in PyMOL