Citrus Sinensis ID: 033334


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHAVHQH
ccEEEEEEccccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEEccccccCEEEEEEECccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccCCccccHHHHHcc
MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHA****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHAVHQH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Macrophage migration inhibitory factor Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.probableP30904
Macrophage migration inhibitory factor Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.probableQ6DN04
Macrophage migration inhibitory factor Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.probableP80928

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.3.-.-Intramolecular oxidoreductases.probable
5.3.2.-Interconverting keto- and enol- groups.probable
5.3.3.-Transposing C==C bonds.probable
5.3.3.12L-dopachrome isomerase.probable
5.3.2.1Phenylpyruvate tautomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WKB, chain A
Confidence level:very confident
Coverage over the Query: 4-117
View the alignment between query and template
View the model in PyMOL