Citrus Sinensis ID: 033334

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHAVHQH
ccEEEEEEccccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEEccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccEEccccHHHHHcc
ccEEEEEEccccccccHccHHHHHHHHHHHHHcccHHHcEEEEEcccEEEEccEccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEccHcHccccccHHHHHHcc
mpclnistnvkldgvdtssiLSEATSTVANIIGKPEAYVMIVLKgsvpmsfggtedpaaygelvsigglnpdvNKKLSAAISAILEKKlsvpksrffikfydtkahqsreHAQCLHAVHQH
mpclnistnvkldgvdtSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILekklsvpksrFFIKFYDTKAHQSREHAQCLHAVHQH
MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHAVHQH
********NVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKA****************
MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHA****
MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHAVHQH
MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHAVHQ*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHAVHQH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
P81529114 Macrophage migration inhi N/A no 0.818 0.868 0.42 8e-16
P91850115 Macrophage migration inhi N/A no 0.859 0.904 0.4 5e-15
P81748114 Macrophage migration inhi N/A no 0.859 0.912 0.342 4e-14
O44786115 Macrophage migration inhi N/A no 0.859 0.904 0.390 1e-13
Q76BK2115 Macrophage migration inhi N/A no 0.859 0.904 0.380 2e-12
Q02960115 Macrophage migration inhi yes no 0.859 0.904 0.361 6e-11
A9JSE7115 Macrophage migration inhi yes no 0.834 0.878 0.352 2e-10
P34884115 Macrophage migration inhi yes no 0.859 0.904 0.333 3e-09
P30904115 Macrophage migration inhi yes no 0.859 0.904 0.333 3e-09
O55052115 Macrophage migration inhi N/A no 0.859 0.904 0.323 4e-09
>sp|P81529|MIFH_TRISP Macrophage migration inhibitory factor homolog OS=Trichinella spiralis PE=1 SV=2 Back     alignment and function desciption
 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 1/100 (1%)

Query: 1   MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAY 60
           MP   ++TN+K   V  S  LS  ++ V NI+ KP +YV + +     +SFGG+  PAA+
Sbjct: 1   MPIFTLNTNIKATDV-PSDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTKPAAF 59

Query: 61  GELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKF 100
           G L+SIGG+ P  N+  SA +   L KKL +PK+R +I F
Sbjct: 60  GTLMSIGGIEPSRNRDHSAKLFDHLNKKLGIPKNRMYIHF 99
Tautomerization of the methyl ester of L-dopachrome. Inhibits migration of human peripheral blood mononuclear cells.
Trichinella spiralis (taxid: 6334)
EC: 5EC: .EC: 3EC: .EC: 3EC: .EC: 1EC: 2
>sp|P91850|MIFH_BRUMA Macrophage migration inhibitory factor homolog OS=Brugia malayi GN=Bm1_28435 PE=3 SV=4 Back     alignment and function description
>sp|P81748|MIFH_TRITR Macrophage migration inhibitory factor homolog OS=Trichuris trichiura PE=1 SV=2 Back     alignment and function description
>sp|O44786|MIFH_WUCBA Macrophage migration inhibitory factor homolog OS=Wuchereria bancrofti GN=MIF PE=3 SV=3 Back     alignment and function description
>sp|Q76BK2|MIF_XENLA Macrophage migration inhibitory factor OS=Xenopus laevis GN=mif PE=1 SV=1 Back     alignment and function description
>sp|Q02960|MIF_CHICK Macrophage migration inhibitory factor OS=Gallus gallus GN=MIF PE=2 SV=3 Back     alignment and function description
>sp|A9JSE7|MIF_XENTR Macrophage migration inhibitory factor OS=Xenopus tropicalis GN=mif PE=3 SV=1 Back     alignment and function description
>sp|P34884|MIF_MOUSE Macrophage migration inhibitory factor OS=Mus musculus GN=Mif PE=1 SV=2 Back     alignment and function description
>sp|P30904|MIF_RAT Macrophage migration inhibitory factor OS=Rattus norvegicus GN=Mif PE=1 SV=4 Back     alignment and function description
>sp|O55052|MIF_MERUN Macrophage migration inhibitory factor OS=Meriones unguiculatus GN=MIF PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
449532378121 PREDICTED: macrophage migration inhibito 1.0 1.0 0.884 5e-58
238481186122 macrophage migration inhibitory factor f 1.0 0.991 0.892 7e-58
388512703121 unknown [Lotus japonicus] 1.0 1.0 0.876 1e-57
359481200121 PREDICTED: macrophage migration inhibito 1.0 1.0 0.876 5e-57
255637539121 unknown [Glycine max] 1.0 1.0 0.842 1e-54
115483767121 Os11g0107500 [Oryza sativa Japonica Grou 0.991 0.991 0.783 1e-53
226500238121 macrophage migration inhibitory factor [ 1.0 1.0 0.793 2e-53
224091052121 predicted protein [Populus trichocarpa] 1.0 1.0 0.801 1e-52
357161293121 PREDICTED: macrophage migration inhibito 0.991 0.991 0.766 2e-51
449532380115 PREDICTED: macrophage migration inhibito 0.884 0.930 0.878 2e-48
>gi|449532378|ref|XP_004173158.1| PREDICTED: macrophage migration inhibitory factor homolog isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  227 bits (579), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 117/121 (96%)

Query: 1   MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAY 60
           MPCLNISTNV L+G+DTSS+LSEA+STVA IIGKPEAYVMIVLKGSVPMSFGG+E PAAY
Sbjct: 1   MPCLNISTNVNLEGIDTSSVLSEASSTVAKIIGKPEAYVMIVLKGSVPMSFGGSEQPAAY 60

Query: 61  GELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHAVHQ 120
           GELVSIGGLNPDVNKKLSAAISAILE KLSVPKSRFF+KFYDTKAHQS+E+AQCLHA+HQ
Sbjct: 61  GELVSIGGLNPDVNKKLSAAISAILETKLSVPKSRFFLKFYDTKAHQSQEYAQCLHALHQ 120

Query: 121 H 121
           +
Sbjct: 121 N 121

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|238481186|ref|NP_001154692.1| macrophage migration inhibitory factor family protein [Arabidopsis thaliana] gi|332002989|gb|AED90372.1| macrophage migration inhibitory factor family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388512703|gb|AFK44413.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|359481200|ref|XP_003632591.1| PREDICTED: macrophage migration inhibitory factor homolog isoform 2 [Vitis vinifera] gi|297735608|emb|CBI18102.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255637539|gb|ACU19096.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|115483767|ref|NP_001065545.1| Os11g0107500 [Oryza sativa Japonica Group] gi|108863913|gb|ABA91099.2| Macrophage migration inhibitory factor family protein, expressed [Oryza sativa Japonica Group] gi|113644249|dbj|BAF27390.1| Os11g0107500 [Oryza sativa Japonica Group] gi|215768056|dbj|BAH00285.1| unnamed protein product [Oryza sativa Japonica Group] gi|222616477|gb|EEE52609.1| hypothetical protein OsJ_34938 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|226500238|ref|NP_001150717.1| macrophage migration inhibitory factor [Zea mays] gi|195641290|gb|ACG40113.1| macrophage migration inhibitory factor [Zea mays] gi|413924641|gb|AFW64573.1| macrophage migration inhibitory factor isoform 1 [Zea mays] gi|413924642|gb|AFW64574.1| macrophage migration inhibitory factor isoform 2 [Zea mays] Back     alignment and taxonomy information
>gi|224091052|ref|XP_002309161.1| predicted protein [Populus trichocarpa] gi|222855137|gb|EEE92684.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357161293|ref|XP_003579043.1| PREDICTED: macrophage migration inhibitory factor homolog isoform 2 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|449532380|ref|XP_004173159.1| PREDICTED: macrophage migration inhibitory factor homolog isoform 2 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
TAIR|locus:2149830122 AT5G01650 "AT5G01650" [Arabido 1.0 0.991 0.892 8.9e-54
TAIR|locus:2098272112 AT3G51660 "AT3G51660" [Arabido 0.842 0.910 0.480 2.1e-22
ZFIN|ZDB-GENE-080708-1115 mif "macrophage migration inhi 0.834 0.878 0.382 3.4e-13
GENEDB_PFALCIPARUM|PFL1420w116 PFL1420w "macrophage migration 0.867 0.905 0.314 3.1e-12
UNIPROTKB|Q8I5C5116 MIF "Macrophage migration inhi 0.867 0.905 0.314 3.1e-12
UNIPROTKB|Q02960115 MIF "Macrophage migration inhi 0.859 0.904 0.361 6.4e-12
MGI|MGI:96982115 Mif "macrophage migration inhi 0.859 0.904 0.333 1.5e-10
RGD|621163115 Mif "macrophage migration inhi 0.859 0.904 0.333 1.5e-10
UNIPROTKB|P14174115 MIF "Macrophage migration inhi 0.859 0.904 0.323 2e-10
UNIPROTKB|O55052115 MIF "Macrophage migration inhi 0.859 0.904 0.323 2e-10
TAIR|locus:2149830 AT5G01650 "AT5G01650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 556 (200.8 bits), Expect = 8.9e-54, P = 8.9e-54
 Identities = 108/121 (89%), Positives = 115/121 (95%)

Query:     1 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAY 60
             MPCLN+STNV LDGVDTSSILSEA+STVA IIGKPE YVMIVLKGSVPMSFGGTEDPAAY
Sbjct:     1 MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKGSVPMSFGGTEDPAAY 60

Query:    61 GELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLHAVHQ 120
             GELVSIGGLN DVNKKLSAA+SAILE KLSVPKSRFF+KFYDTK HQS+E+AQCLHA+HQ
Sbjct:    61 GELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTKDHQSQEYAQCLHALHQ 120

Query:   121 H 121
             H
Sbjct:   121 H 121
GO:0003674 "molecular_function" evidence=ND
GO:0006954 "inflammatory response" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0051707 "response to other organism" evidence=ISS
TAIR|locus:2098272 AT3G51660 "AT3G51660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080708-1 mif "macrophage migration inhibitory factor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFL1420w PFL1420w "macrophage migration inhibitory factor homolog, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I5C5 MIF "Macrophage migration inhibitory factor homologue" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q02960 MIF "Macrophage migration inhibitory factor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:96982 Mif "macrophage migration inhibitory factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621163 Mif "macrophage migration inhibitory factor (glycosylation-inhibiting factor)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P14174 MIF "Macrophage migration inhibitory factor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O55052 MIF "Macrophage migration inhibitory factor" [Meriones unguiculatus (taxid:10047)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P30904MIF_RAT5, ., 3, ., 3, ., 1, 20.33330.85950.9043yesno
Q6DN04MIF_MACMU5, ., 3, ., 3, ., 1, 20.32380.85950.9043yesno
A9JSE7MIF_XENTR5, ., 3, ., 3, ., 1, 20.35290.83470.8782yesno
P34884MIF_MOUSE5, ., 3, ., 3, ., 1, 20.33330.85950.9043yesno
P80928MIF_PIG5, ., 3, ., 3, ., 1, 20.31420.85950.9043yesno
P14174MIF_HUMAN5, ., 3, ., 3, ., 1, 20.32380.85950.9043yesno
Q02960MIF_CHICK5, ., 3, ., 3, ., 1, 20.36190.85950.9043yesno
P80177MIF_BOVIN5, ., 3, ., 3, ., 1, 20.32380.85950.9043yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.120.824
3rd Layer5.3.30.766
3rd Layer5.3.2.10.824
3rd Layer5.3.20.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT5G01650
macrophage migration inhibitory factor family protein / MIF family protein; macrophage migration inhibitory factor family protein / MIF family protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- inflammatory response, response to other organism; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Tautomerase (InterPro-IPR014347), Macrophage migration inhibitory factor (InterPro-IPR001398); BEST Arabidopsis thaliana protein match is- macrophage migration inhibitory factor family protein / MIF family protein (TAIR-AT5G57170.1). (122 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
MIF3
MIF3 (MINI ZINC FINGER); MINI ZINC FINGER (MIF3); CONTAINS InterPro DOMAIN/s- ZF-HD homeobox pr [...] (88 aa)
      • 0.925
KDR
KDR (KIDARI); transcription regulator; Encodes a basic helix-loop-helix (bHLH) protein involved [...] (94 aa)
      • 0.873
ZPR3
ZPR3 (LITTLE ZIPPER 3); protein binding; ZPR3 is a small-leucine zipper containing protein that [...] (67 aa)
      • 0.871
SPT42
SPT42 (SPT4 HOMOLOG 2); positive transcription elongation factor/ zinc ion binding; SPT4 HOMOLO [...] (116 aa)
   •    0.524
TOM5
TOM5 (MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM5 HOMOLOG); MITOCHONDRIAL IMPORT RECEPTOR SUBUNI [...] (54 aa)
   •    0.466
AT1G33810
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (138 aa)
   •    0.427
AT5G52780
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (168 aa)
  •     0.410

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
PTZ00397116 PTZ00397, PTZ00397, macrophage migration inhibitio 6e-25
pfam01187114 pfam01187, MIF, Macrophage migration inhibitory fa 9e-20
PTZ00450113 PTZ00450, PTZ00450, macrophage migration inhibitor 5e-16
>gnl|CDD|240401 PTZ00397, PTZ00397, macrophage migration inhibition factor-like protein; Provisional Back     alignment and domain information 
 Score = 90.7 bits (225), Expect = 6e-25
 Identities = 37/106 (34%), Positives = 57/106 (53%)

Query: 1   MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAY 60
           MPC  +STNV        + LS+  + +A+++GKP +Y+M        M FGG+ D   +
Sbjct: 1   MPCCQVSTNVNATDDQADAALSDIENAIADVLGKPLSYIMSGYDYQKHMRFGGSHDGCCF 60

Query: 61  GELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAH 106
             + SIGG++   N  ++AAI+ IL   L V   R +I+F D  A 
Sbjct: 61  VRVTSIGGISRSNNSSIAAAITKILASHLKVKSERVYIEFKDCSAQ 106

Length = 116
>gnl|CDD|201647 pfam01187, MIF, Macrophage migration inhibitory factor (MIF) Back     alignment and domain information
>gnl|CDD|185629 PTZ00450, PTZ00450, macrophage migration inhibitory factor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
PTZ00450113 macrophage migration inhibitory factor-like protei 100.0
PTZ00397116 macrophage migration inhibition factor-like protei 100.0
PF01187114 MIF: Macrophage migration inhibitory factor (MIF); 100.0
KOG1759115 consensus Macrophage migration inhibitory factor [ 100.0
PF1455282 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AA 99.61
PRK0196464 4-oxalocrotonate tautomerase; Provisional 99.57
PF0136160 Tautomerase: Tautomerase enzyme; InterPro: IPR0043 99.56
TIGR0001363 taut 4-oxalocrotonate tautomerase family enzyme. 4 99.56
cd0049158 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tauto 99.56
PRK0222061 4-oxalocrotonate tautomerase; Provisional 99.55
PRK0074562 4-oxalocrotonate tautomerase; Provisional 99.54
PRK0228960 4-oxalocrotonate tautomerase; Provisional 99.38
COG194269 Uncharacterized protein, 4-oxalocrotonate tautomer 99.35
cd00580113 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase ( 99.35
PF14832136 Tautomerase_3: Putative oxalocrotonate tautomerase 99.15
PRK0127176 4-oxalocrotonate tautomerase; Provisional 99.08
PF08921108 DUF1904: Domain of unknown function (DUF1904); Int 99.02
PRK0196464 4-oxalocrotonate tautomerase; Provisional 99.02
PRK0074562 4-oxalocrotonate tautomerase; Provisional 98.97
PRK0228960 4-oxalocrotonate tautomerase; Provisional 98.95
PRK0222061 4-oxalocrotonate tautomerase; Provisional 98.91
PRK15031126 5-carboxymethyl-2-hydroxymuconate delta-isomerase; 98.89
COG194269 Uncharacterized protein, 4-oxalocrotonate tautomer 98.86
PF0136160 Tautomerase: Tautomerase enzyme; InterPro: IPR0043 98.67
TIGR0001363 taut 4-oxalocrotonate tautomerase family enzyme. 4 98.65
cd0049158 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tauto 98.65
PRK0127176 4-oxalocrotonate tautomerase; Provisional 98.65
PF02962124 CHMI: 5-carboxymethyl-2-hydroxymuconate isomerase; 98.47
PTZ00397116 macrophage migration inhibition factor-like protei 97.74
COG3232127 HpaF 5-carboxymethyl-2-hydroxymuconate isomerase [ 97.56
PF1455282 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AA 97.45
PF14832136 Tautomerase_3: Putative oxalocrotonate tautomerase 97.17
PTZ00450113 macrophage migration inhibitory factor-like protei 96.2
PF01187114 MIF: Macrophage migration inhibitory factor (MIF); 95.35
TIGR02544193 III_secr_YscJ type III secretion apparatus lipopro 92.7
cd00580113 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase ( 92.31
TIGR02830186 spore_III_AG stage III sporulation protein AG. CC 91.01
PRK0064796 hypothetical protein; Validated 89.56
KOG1759115 consensus Macrophage migration inhibitory factor [ 89.07
PF1109086 DUF2833: Protein of unknown function (DUF2833); In 88.55
PRK0509095 hypothetical protein; Validated 87.65
PF08921108 DUF1904: Domain of unknown function (DUF1904); Int 87.59
KOG4493219 consensus Uncharacterized conserved protein [Funct 87.23
PF0259477 DUF167: Uncharacterised ACR, YggU family COG1872; 85.73
cd00673232 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II 84.6
COG3887 655 Predicted signaling protein consisting of a modifi 83.92
PRK15348249 type III secretion system lipoprotein SsaJ; Provis 82.25
PRK14538 838 putative bifunctional signaling protein/50S riboso 81.96
PF09581188 Spore_III_AF: Stage III sporulation protein AF (Sp 81.46
>PTZ00450 macrophage migration inhibitory factor-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.7e-43  Score=225.16  Aligned_cols=112  Identities=31%  Similarity=0.534  Sum_probs=103.7

Q ss_pred             CCeEEEEeCCCCCCcChHHHHHHH-HHHHHHHhCCCCcEEEEEEeCCceeeecCCCCCeeEEEEEeeeCCChhHHHHHHH
Q 033334            1 MPCLNISTNVKLDGVDTSSILSEA-TSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSA   79 (121)
Q Consensus         1 MP~i~i~tn~~~~~~~~~~~~~~l-~~~~~~~~~kp~~~i~v~v~~~~~~~~gg~~~p~~~v~i~~~g~~~~e~~~~~~~   79 (121)
                      ||+++++||++.+++++ +++++. ++++++++||||+|+||++++++.|+|||+++||||++|+++|++++++|+++++
T Consensus         1 MP~~~i~tNv~~~~~~~-~~l~~~~~~~~a~~lgKPe~yvmV~~~~~~~m~fgGs~~P~A~~~l~siG~~~~~~n~~~s~   79 (113)
T PTZ00450          1 MPFLQTIVSVSLDDQKR-ANLSQAYRMICREELGKPEDFVMTAFSDSTPMSFQGSTAPAAYVRVEAWGEYAPSKPKMMTP   79 (113)
T ss_pred             CCEEEEEecCCCcccCH-HHHHHHHHHHHHHhhCCCHHHEEEEEeCCceEEEcCCCCCEEEEEEEEecCcCHHHHHHHHH
Confidence            99999999999877644 555555 5577799999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhCCCCCeEEEEEEeCCCCCceeCCcee
Q 033334           80 AISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCL  115 (121)
Q Consensus        80 ~i~~~l~~~lgi~~~ri~i~f~~~~~~~~g~~G~~~  115 (121)
                      +||++++++||||++||||.|+|.  .+|||||+||
T Consensus        80 ~i~~~l~~~LgIp~dRiYI~f~d~--~~~G~nG~tF  113 (113)
T PTZ00450         80 RITAAITKECGIPAERIYVFYYST--KHCGWNGTNF  113 (113)
T ss_pred             HHHHHHHHHcCCCcccEEEEEEcH--HHcccCcEeC
Confidence            999999999999999999999995  7899999997

>PTZ00397 macrophage migration inhibition factor-like protein; Provisional Back     alignment and domain information
>PF01187 MIF: Macrophage migration inhibitory factor (MIF); InterPro: IPR001398 Macrophage migration inhibitory factor (MIF) is a key regulatory cytokine within innate and adaptive immune responses, capable of promoting and modulating the magnitude of the response [] Back     alignment and domain information
>KOG1759 consensus Macrophage migration inhibitory factor [Defense mechanisms] Back     alignment and domain information
>PF14552 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C Back     alignment and domain information
>PRK01964 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PF01361 Tautomerase: Tautomerase enzyme; InterPro: IPR004370 4-Oxalocrotonate tautomerase (4-OT) catalyzes the isomerisation of beta,gamma-unsaturated enones to their alpha,beta-isomers Back     alignment and domain information
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme Back     alignment and domain information
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase: Catalyzes the isomerization of unsaturated ketones Back     alignment and domain information
>PRK02220 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK00745 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK02289 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>COG1942 Uncharacterized protein, 4-oxalocrotonate tautomerase homolog [General function prediction only] Back     alignment and domain information
>cd00580 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) is a trimeric enzyme catalyzing the isomerization of the unsaturated ketone 5-(carboxymethyl)-2-hydroxymuconate to 5-(carboxymethyl)-2-oxo-3-hexene-1,6-dionate Back     alignment and domain information
>PF14832 Tautomerase_3: Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A Back     alignment and domain information
>PRK01271 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PF08921 DUF1904: Domain of unknown function (DUF1904); InterPro: IPR015017 This entry represents a family of hypothetical bacterial proteins Back     alignment and domain information
>PRK01964 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK00745 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK02289 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK02220 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK15031 5-carboxymethyl-2-hydroxymuconate delta-isomerase; Provisional Back     alignment and domain information
>COG1942 Uncharacterized protein, 4-oxalocrotonate tautomerase homolog [General function prediction only] Back     alignment and domain information
>PF01361 Tautomerase: Tautomerase enzyme; InterPro: IPR004370 4-Oxalocrotonate tautomerase (4-OT) catalyzes the isomerisation of beta,gamma-unsaturated enones to their alpha,beta-isomers Back     alignment and domain information
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme Back     alignment and domain information
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase: Catalyzes the isomerization of unsaturated ketones Back     alignment and domain information
>PRK01271 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PF02962 CHMI: 5-carboxymethyl-2-hydroxymuconate isomerase; InterPro: IPR004220 5-carboxymethyl-2-hydroxymuconate isomerase transforms 5-carboxymethyl-2-hydroxy-muconic acid into 5-oxo-pent-3-ene-1,2,5-tricarboxylic acid during the third step of the homoprotocatechuate catabolic pathway [] Back     alignment and domain information
>PTZ00397 macrophage migration inhibition factor-like protein; Provisional Back     alignment and domain information
>COG3232 HpaF 5-carboxymethyl-2-hydroxymuconate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PF14552 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C Back     alignment and domain information
>PF14832 Tautomerase_3: Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A Back     alignment and domain information
>PTZ00450 macrophage migration inhibitory factor-like protein; Provisional Back     alignment and domain information
>PF01187 MIF: Macrophage migration inhibitory factor (MIF); InterPro: IPR001398 Macrophage migration inhibitory factor (MIF) is a key regulatory cytokine within innate and adaptive immune responses, capable of promoting and modulating the magnitude of the response [] Back     alignment and domain information
>TIGR02544 III_secr_YscJ type III secretion apparatus lipoprotein, YscJ/HrcJ family Back     alignment and domain information
>cd00580 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) is a trimeric enzyme catalyzing the isomerization of the unsaturated ketone 5-(carboxymethyl)-2-hydroxymuconate to 5-(carboxymethyl)-2-oxo-3-hexene-1,6-dionate Back     alignment and domain information
>TIGR02830 spore_III_AG stage III sporulation protein AG Back     alignment and domain information
>PRK00647 hypothetical protein; Validated Back     alignment and domain information
>KOG1759 consensus Macrophage migration inhibitory factor [Defense mechanisms] Back     alignment and domain information
>PF11090 DUF2833: Protein of unknown function (DUF2833); InterPro: IPR020335 This entry contains proteins with no known function Back     alignment and domain information
>PRK05090 hypothetical protein; Validated Back     alignment and domain information
>PF08921 DUF1904: Domain of unknown function (DUF1904); InterPro: IPR015017 This entry represents a family of hypothetical bacterial proteins Back     alignment and domain information
>KOG4493 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02594 DUF167: Uncharacterised ACR, YggU family COG1872; InterPro: IPR003746 This entry describes proteins of unknown function Back     alignment and domain information
>cd00673 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain Back     alignment and domain information
>COG3887 Predicted signaling protein consisting of a modified GGDEF domain and a DHH domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15348 type III secretion system lipoprotein SsaJ; Provisional Back     alignment and domain information
>PRK14538 putative bifunctional signaling protein/50S ribosomal protein L9; Provisional Back     alignment and domain information
>PF09581 Spore_III_AF: Stage III sporulation protein AF (Spore_III_AF); InterPro: IPR014245 This family represents the stage III sporulation protein AF (SpoIIIAF) of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
2xcz_A115 Crystal Structure Of Macrophage Migration Inhibitor 5e-16
1hfo_A113 The Structure Of The Macrophage Migration Inhibitor 7e-16
4dh4_A114 Macrophage Migration Inhibitory Factor Toxoplasma G 2e-14
1uiz_A115 Crystal Structure Of Macrophage Migration Inhibitor 2e-13
2wkf_A125 Crystal Structure Of Macrophage Migration Inhibitor 2e-12
3gac_A117 Structure Of Mif With Hpp Length = 117 5e-12
2wkb_A125 Crystal Structure Of Macrophage Migration Inhibitor 4e-11
2wkf_B125 Crystal Structure Of Macrophage Migration Inhibitor 7e-11
3fwt_A133 Crystal Structure Of Leishmania Major Mif2 Length = 2e-10
1mif_A115 Macrophage Migration Inhibitory Factor (Mif) Length 4e-10
3hof_A123 Structure Of Macrophage Migration Inhibitory Factor 4e-10
1gif_A115 Human Glycosylation-Inhibiting Factor Length = 115 4e-10
1mff_A114 Macrophage Migration Inhibitory Factor Y95f Mutant 4e-10
1mfi_A114 Crystal Structure Of Macrophage Migration Inhibitor 1e-09
4evg_A114 Crystal Structure Of Mif L46a Mutant Length = 114 1e-09
4etg_A114 Crystal Structure Of Mif L46g Mutant Length = 114 2e-09
1gcz_A122 Macrophage Migration Inhibitory Factor (Mif) Comple 2e-09
1ca7_A114 Macrophage Migration Inhibitory Factor (Mif) With H 2e-09
4eui_A114 Crystal Structure Of Mif L46f Mutant Length = 114 2e-09
1p1g_A114 Macrophage Migration Inhibitory Factor (Mif) With P 3e-09
1cgq_A115 Macrophage Migration Inhibitory Factor (Mif) With A 3e-09
3fwu_A133 Crystal Structure Of Leishmania Major Mif1 Length = 5e-09
1fim_A114 Macrophage Migration Inhibitory Factor Length = 114 5e-09
3b64_A112 Macrophage Migration Inhibitory Factor (Mif) From L 2e-08
3t5s_A135 Structure Of Macrophage Migration Inhibitory Factor 5e-08
1dpt_A117 D-Dopachrome Tautomerase Length = 117 2e-05
2os5_A119 Macrophage Migration Inhibitory Factor From Ancylos 4e-05
3rf4_A116 Ancylostoma Ceylanicum Mif In Complex With Furosemi 2e-04
>pdb|2XCZ|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor Homologue From Prochlorococcus Marinus Length = 115 Back     alignment and structure 
Iteration: 1

 Score = 79.3 bits (194), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 1/106 (0%)
Query: 1   MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAY 60
           MP +NI  +V     D +S+L E +S +A ++GKPE YVM  L+  VPM+F G  +P  Y
Sbjct: 1   MPLINIQASVPAV-ADANSLLQELSSKLAELLGKPEKYVMTSLQCGVPMTFSGNTEPTCY 59
Query: 61  GELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAH 106
            E+ SIG L+    +++S  +   +E+ L +P  R +I F D  A 
Sbjct: 60  VEVKSIGALDGSRTQEVSELVCGHIEQNLGIPADRIYIGFEDVPAR 105
>pdb|1HFO|A Chain A, The Structure Of The Macrophage Migration Inhibitory Factor From Trichinella Spiralis. Length = 113 Back     alignment and structure
>pdb|4DH4|A Chain A, Macrophage Migration Inhibitory Factor Toxoplasma Gondii Length = 114 Back     alignment and structure
>pdb|1UIZ|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor From Xenopus Laevis. Length = 115 Back     alignment and structure
>pdb|2WKF|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor From Plasmodium Falciparum Length = 125 Back     alignment and structure
>pdb|3GAC|A Chain A, Structure Of Mif With Hpp Length = 117 Back     alignment and structure
>pdb|2WKB|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor From Plasmodium Berghei Length = 125 Back     alignment and structure
>pdb|2WKF|B Chain B, Crystal Structure Of Macrophage Migration Inhibitory Factor From Plasmodium Falciparum Length = 125 Back     alignment and structure
>pdb|3FWT|A Chain A, Crystal Structure Of Leishmania Major Mif2 Length = 133 Back     alignment and structure
>pdb|1MIF|A Chain A, Macrophage Migration Inhibitory Factor (Mif) Length = 115 Back     alignment and structure
>pdb|3HOF|A Chain A, Structure Of Macrophage Migration Inhibitory Factor (Mif) With Caffeic Acid At 1.9a Resolution Length = 123 Back     alignment and structure
>pdb|1GIF|A Chain A, Human Glycosylation-Inhibiting Factor Length = 115 Back     alignment and structure
>pdb|1MFF|A Chain A, Macrophage Migration Inhibitory Factor Y95f Mutant Length = 114 Back     alignment and structure
>pdb|1MFI|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor Complexed With (E)-2-Fluoro-P-Hydroxycinnamate Length = 114 Back     alignment and structure
>pdb|4EVG|A Chain A, Crystal Structure Of Mif L46a Mutant Length = 114 Back     alignment and structure
>pdb|4ETG|A Chain A, Crystal Structure Of Mif L46g Mutant Length = 114 Back     alignment and structure
>pdb|1GCZ|A Chain A, Macrophage Migration Inhibitory Factor (Mif) Complexed With Inhibitor. Length = 122 Back     alignment and structure
>pdb|1CA7|A Chain A, Macrophage Migration Inhibitory Factor (Mif) With Hydroxphenylpyruvate Length = 114 Back     alignment and structure
>pdb|4EUI|A Chain A, Crystal Structure Of Mif L46f Mutant Length = 114 Back     alignment and structure
>pdb|1P1G|A Chain A, Macrophage Migration Inhibitory Factor (Mif) With Pro-1 Mutated To Gly-1 Length = 114 Back     alignment and structure
>pdb|1CGQ|A Chain A, Macrophage Migration Inhibitory Factor (Mif) With Alanine Inserted Between Pro-1 And Met-2 Length = 115 Back     alignment and structure
>pdb|3FWU|A Chain A, Crystal Structure Of Leishmania Major Mif1 Length = 133 Back     alignment and structure
>pdb|1FIM|A Chain A, Macrophage Migration Inhibitory Factor Length = 114 Back     alignment and structure
>pdb|3B64|A Chain A, Macrophage Migration Inhibitory Factor (Mif) From LEISHMANIA MAJOR Length = 112 Back     alignment and structure
>pdb|3T5S|A Chain A, Structure Of Macrophage Migration Inhibitory Factor From Giardia Lamblia Length = 135 Back     alignment and structure
>pdb|1DPT|A Chain A, D-Dopachrome Tautomerase Length = 117 Back     alignment and structure
>pdb|2OS5|A Chain A, Macrophage Migration Inhibitory Factor From Ancylostoma Ceylanicum Length = 119 Back     alignment and structure
>pdb|3RF4|A Chain A, Ancylostoma Ceylanicum Mif In Complex With Furosemide Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
3b64_A112 Macrophage migration inhibitory factor-like protei 1e-43
3fwt_A133 Macrophage migration inhibitory factor-like protei 4e-43
2wkb_A125 Macrophage migration inhibitory factor; cytokine; 5e-42
3fwu_A133 Macrophage migration inhibitory factor-like protei 9e-42
2xcz_A115 Possible ATLS1-like light-inducible protein; cytok 2e-41
1uiz_A115 MIF, macrophage migration inhibitory factor; cytok 3e-41
2os5_A119 Acemif; macrophage migration inhibitory factor, cy 5e-41
3t5s_A135 Gilaa.00834.A, macrophage migration inhibitory fac 8e-41
3djh_A114 Macrophage migration inhibitory factor; homotrimer 5e-40
1hfo_A113 Migration inhibitory factor; tautomerase; 1.65A {T 8e-40
3kan_A117 D-dopachrome tautomerase; immune response, cytokin 1e-37
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major} Length = 112 Back     alignment and structure
 Score =  137 bits (347), Expect = 1e-43
 Identities = 25/103 (24%), Positives = 50/103 (48%)

Query: 2   PCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYG 61
           P +    +  LD     ++     +   +++GKPE  VM+    S PM F G+ DP A  
Sbjct: 1   PVIQTFVSTPLDHHKRENLAQVYRAVTRDVLGKPEDLVMMTFHDSTPMHFFGSTDPVACV 60

Query: 62  ELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTK 104
            + ++GG  P   +K+++ ++A + K+  +   R F+ ++   
Sbjct: 61  RVEALGGYGPSEPEKVTSIVTAAITKECGIVADRIFVLYFSPL 103
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major} Length = 133 Back     alignment and structure
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A* Length = 125 Back     alignment and structure
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major} Length = 133 Back     alignment and structure
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus} Length = 115 Back     alignment and structure
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3 Length = 115 Back     alignment and structure
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode,; 1.60A {Ancylostoma ceylanicum} PDB: 3rf4_A* 3rf5_A* Length = 119 Back     alignment and structure
>3t5s_A Gilaa.00834.A, macrophage migration inhibitory factor; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Giardia lamblia} Length = 135 Back     alignment and structure
>3djh_A Macrophage migration inhibitory factor; homotrimer, cytokine, inflammatory response, isomerase, phosphoprotein; 1.25A {Homo sapiens} PDB: 1ca7_A* 1ljt_A* 2ooh_A* 2ooz_A* 3b9s_A* 2oow_A* 3ce4_A 3dji_A* 3ijg_A* 3ijj_A* 1gd0_A* 1gcz_A* 3jsf_A* 3jsg_A* 3jtu_A* 3l5p_A* 3l5r_A* 3l5s_A* 3l5t_A* 3l5u_A* ... Length = 114 Back     alignment and structure
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3 Length = 113 Back     alignment and structure
>3kan_A D-dopachrome tautomerase; immune response, cytokine, cytokine-inhibitor C; HET: RW1; 1.13A {Homo sapiens} PDB: 1dpt_A* 3ker_A* Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
3djh_A114 Macrophage migration inhibitory factor; homotrimer 100.0
3kan_A117 D-dopachrome tautomerase; immune response, cytokin 100.0
4dh4_A114 MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} 100.0
3t5s_A135 Gilaa.00834.A, macrophage migration inhibitory fac 100.0
3fwu_A133 Macrophage migration inhibitory factor-like protei 100.0
3fwt_A133 Macrophage migration inhibitory factor-like protei 100.0
1uiz_A115 MIF, macrophage migration inhibitory factor; cytok 100.0
2xcz_A115 Possible ATLS1-like light-inducible protein; cytok 100.0
2wkb_A125 Macrophage migration inhibitory factor; cytokine; 100.0
2os5_A119 Acemif; macrophage migration inhibitory factor, cy 100.0
1hfo_A113 Migration inhibitory factor; tautomerase; 1.65A {T 100.0
3b64_A112 Macrophage migration inhibitory factor-like protei 100.0
2aal_A131 Malonate semialdehyde decarboxylase; tautomerase s 100.0
1mww_A128 Hypothetical protein HI1388.1; structural genomics 99.97
3n4h_A148 Putative tautomerase; CG10062, CIS-3-chloroacrylic 99.93
3mlc_A136 FG41 malonate semialdehyde decarboxylase; tautomer 99.92
3c6v_A161 Probable tautomerase/dehalogenase AU4130; aspergil 99.87
3mf7_A149 CIS-3-chloroacrylic acid dehalogenase; beta-alpha- 99.8
2opa_A61 Probable tautomerase YWHB; homohexamer, 4-oxalocro 99.72
1otf_A62 4-oxalocrotonate tautomerase; isomerase; 1.90A {Ps 99.72
1u9d_A122 Hypothetical protein VC0714; structural genomics, 99.71
3abf_A64 4-oxalocrotonate tautomerase; isomerase; 1.94A {Th 99.69
3m21_A67 Probable tautomerase HP_0924; 4-oxalocrotonate tau 99.69
3m20_A62 4-oxalocrotonate tautomerase, putative; DMPI, ther 99.66
3mb2_A72 4-oxalocrotonate tautomerase family enzyme - ALPH; 99.66
3ry0_A65 Putative tautomerase; oxalocrotonate tautomerase f 99.64
2x4k_A63 4-oxalocrotonate tautomerase; isomerase; 1.10A {St 99.62
3ej9_A76 Alpha-subunit of trans-3-chloroacrylic acid dehal; 99.61
3e6q_A146 Putative 5-carboxymethyl-2-hydroxymuconate isomer; 99.5
1otg_A125 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A 99.42
3ej9_B70 Beta-subunit of trans-3-chloroacrylic acid dehalo; 99.36
1gyx_A76 YDCE, B1461, hypothetical protein YDCE; tautomeras 99.34
3abf_A64 4-oxalocrotonate tautomerase; isomerase; 1.94A {Th 99.31
2x4k_A63 4-oxalocrotonate tautomerase; isomerase; 1.10A {St 99.17
3mb2_A72 4-oxalocrotonate tautomerase family enzyme - ALPH; 99.1
3ej9_A76 Alpha-subunit of trans-3-chloroacrylic acid dehal; 98.95
3n4h_A148 Putative tautomerase; CG10062, CIS-3-chloroacrylic 98.85
3m20_A62 4-oxalocrotonate tautomerase, putative; DMPI, ther 98.77
2aal_A131 Malonate semialdehyde decarboxylase; tautomerase s 98.75
3mlc_A136 FG41 malonate semialdehyde decarboxylase; tautomer 98.72
3c6v_A161 Probable tautomerase/dehalogenase AU4130; aspergil 98.69
3mb2_B72 4-oxalocrotonate tautomerase family enzyme - beta; 98.68
3ry0_A65 Putative tautomerase; oxalocrotonate tautomerase f 98.67
3m21_A67 Probable tautomerase HP_0924; 4-oxalocrotonate tau 98.66
3mf7_A149 CIS-3-chloroacrylic acid dehalogenase; beta-alpha- 98.63
2opa_A61 Probable tautomerase YWHB; homohexamer, 4-oxalocro 98.56
1otf_A62 4-oxalocrotonate tautomerase; isomerase; 1.90A {Ps 98.55
1mww_A128 Hypothetical protein HI1388.1; structural genomics 98.49
3ej9_B70 Beta-subunit of trans-3-chloroacrylic acid dehalo; 98.44
2wkb_A125 Macrophage migration inhibitory factor; cytokine; 98.21
3b64_A112 Macrophage migration inhibitory factor-like protei 98.12
2xcz_A115 Possible ATLS1-like light-inducible protein; cytok 98.07
1hfo_A113 Migration inhibitory factor; tautomerase; 1.65A {T 98.06
1gyx_A76 YDCE, B1461, hypothetical protein YDCE; tautomeras 97.98
1uiz_A115 MIF, macrophage migration inhibitory factor; cytok 97.98
2os5_A119 Acemif; macrophage migration inhibitory factor, cy 97.89
1u9d_A122 Hypothetical protein VC0714; structural genomics, 97.66
3t5s_A135 Gilaa.00834.A, macrophage migration inhibitory fac 97.53
3fwu_A133 Macrophage migration inhibitory factor-like protei 97.45
4dh4_A114 MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} 97.32
3fwt_A133 Macrophage migration inhibitory factor-like protei 97.23
3djh_A114 Macrophage migration inhibitory factor; homotrimer 97.03
3mb2_B72 4-oxalocrotonate tautomerase family enzyme - beta; 96.82
3kan_A117 D-dopachrome tautomerase; immune response, cytokin 95.75
1otg_A125 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A 95.58
1n91_A108 ORF, hypothetical protein; alpha+beta, northeast s 91.1
2y9j_Y170 Lipoprotein PRGK, protein PRGK; protein transport, 87.44
3e6q_A146 Putative 5-carboxymethyl-2-hydroxymuconate isomer; 85.64
3lax_A109 Phenylacetate-coenzyme A ligase; structural genomi 81.86
>3djh_A Macrophage migration inhibitory factor; homotrimer, cytokine, inflammatory response, isomerase, phosphoprotein; 1.25A {Homo sapiens} SCOP: d.80.1.3 PDB: 1ca7_A* 1ljt_A* 2ooh_A* 2ooz_A* 3b9s_A* 2oow_A* 3ce4_A 3dji_A* 3ijg_A* 3ijj_A* 3smb_A* 3smc_A* 3u18_A* 4f2k_A* 1gd0_A* 1gcz_A* 3jsf_A* 3jsg_A* 3jtu_A* 3l5p_A* ... Back     alignment and structure
Probab=100.00  E-value=5.5e-43  Score=225.27  Aligned_cols=114  Identities=29%  Similarity=0.502  Sum_probs=111.3

Q ss_pred             CeEEEEeCCCCCCcChHHHHHHHHHHHHHHhCCCCcEEEEEEeCCceeeecCCCCCeeEEEEEeeeCCChhHHHHHHHHH
Q 033334            2 PCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAI   81 (121)
Q Consensus         2 P~i~i~tn~~~~~~~~~~~~~~l~~~~~~~~~kp~~~i~v~v~~~~~~~~gg~~~p~~~v~i~~~g~~~~e~~~~~~~~i   81 (121)
                      |+++++||++.+++ +++|++++++++|+++|||++|+||++++++.|+|||+++||+|++|+++|++++++|++++++|
T Consensus         1 P~i~~~TNv~~~~~-~~~~~~~ls~~~a~~lgKpe~~vmV~~~~~~~m~fgGs~~P~a~~~v~sig~~~~~~n~~~s~~i   79 (114)
T 3djh_A            1 PMFIVNTNVPRASV-PDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLL   79 (114)
T ss_dssp             CEEEEEESSCGGGS-CTTHHHHHHHHHHHHHCCCGGGCEEEEECSCEEEETTBCSSCEEEEEEESSCCSHHHHHHHHHHH
T ss_pred             CEEEEEecCCcccc-cHHHHHHHHHHHHHHHCCCHHHeEEEEeCCceEEEcCcCCCEEEEEEEEccCCCHHHHHHHHHHH
Confidence            99999999998876 68999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCeEEEEEEeCCCCCceeCCceee
Q 033334           82 SAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLH  116 (121)
Q Consensus        82 ~~~l~~~lgi~~~ri~i~f~~~~~~~~g~~G~~~~  116 (121)
                      +++++++|||+++|+||.|+|++++||||||+||+
T Consensus        80 ~~~l~~~Lgi~~~riyI~f~d~~~~~~g~~G~tf~  114 (114)
T 3djh_A           80 CGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA  114 (114)
T ss_dssp             HHHHHHHHCCCGGGEEEEEEECCGGGEEETTEECC
T ss_pred             HHHHHHHhCcCcceEEEEEEECCHHHeeECCEECc
Confidence            99999999999999999999999999999999984
>3kan_A D-dopachrome tautomerase; immune response, cytokine, cytokine-inhibitor C; HET: RW1; 1.13A {Homo sapiens} SCOP: d.80.1.3 PDB: 1dpt_A* 3ker_A* Back     alignment and structure
>4dh4_A MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} Back     alignment and structure
>3t5s_A Gilaa.00834.A, macrophage migration inhibitory factor; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Giardia lamblia} Back     alignment and structure
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major} Back     alignment and structure
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major} Back     alignment and structure
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3 Back     alignment and structure
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus} Back     alignment and structure
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A* Back     alignment and structure
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode,; 1.60A {Ancylostoma ceylanicum} PDB: 3rf4_A* 3rf5_A* Back     alignment and structure
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3 Back     alignment and structure
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major} Back     alignment and structure
>2aal_A Malonate semialdehyde decarboxylase; tautomerase superfamily, beta-alpha-beta, homotrimeric, LYAS; 1.65A {Pseudomonas pavonaceae} SCOP: d.80.1.6 PDB: 2aag_A 2aaj_A Back     alignment and structure
>1mww_A Hypothetical protein HI1388.1; structural genomics, structure 2 function project, S2F, unknown function; HET: GLU; 2.08A {Haemophilus influenzae} SCOP: d.80.1.4 Back     alignment and structure
>3n4h_A Putative tautomerase; CG10062, CIS-3-chloroacrylic acid dehalogenase, tautomerase superfamily, beta-alpha-beta motif, hydrolase; HET: PR7; 2.02A {Corynebacterium glutamicum} PDB: 3n4d_A* 3n4g_A Back     alignment and structure
>3mlc_A FG41 malonate semialdehyde decarboxylase; tautomerase superfamily, malonate semialdehyde decarboxylase alpha-beta-motif; 2.22A {Coryneform bacterium} SCOP: d.80.1.0 PDB: 3mjz_A Back     alignment and structure
>3c6v_A Probable tautomerase/dehalogenase AU4130; aspergillus fumigatus trimeric thermophilic probable tautomerase/dehalogenase; HET: MSE; 1.90A {Aspergillus fumigatus AF293} Back     alignment and structure
>3mf7_A CIS-3-chloroacrylic acid dehalogenase; beta-alpha-beta motif, tautomerase, CIS-3-CHLO acid dehalogenase, isomerase, hydrolase; HET: PR4; 1.65A {Coryneform bacterium} PDB: 3mf8_A 2flt_A 2flz_A Back     alignment and structure
>2opa_A Probable tautomerase YWHB; homohexamer, 4-oxalocrotonate tautomerase, inhibitor, 2-FLUO hydroxycinnamate, isomerase; HET: FHC; 2.40A {Bacillus subtilis} PDB: 2op8_A* Back     alignment and structure
>1otf_A 4-oxalocrotonate tautomerase; isomerase; 1.90A {Pseudomonas SP} SCOP: d.80.1.1 PDB: 4otc_A 4ota_A 4otb_A 1bjp_A 2fm7_A Back     alignment and structure
>1u9d_A Hypothetical protein VC0714; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics; 1.70A {Vibrio cholerae o1 biovar eltor str} SCOP: d.80.1.5 Back     alignment and structure
>3abf_A 4-oxalocrotonate tautomerase; isomerase; 1.94A {Thermus thermophilus} Back     alignment and structure
>3m21_A Probable tautomerase HP_0924; 4-oxalocrotonate tautomerase, catalytic proline, hexamer, BE beta, isomerase; 1.90A {Helicobacter pylori} PDB: 2orm_A Back     alignment and structure
>3m20_A 4-oxalocrotonate tautomerase, putative; DMPI, thermophIle, beta-alpha-beta, catalytic proline, isomerase; 2.37A {Archaeoglobus fulgidus} Back     alignment and structure
>3mb2_A 4-oxalocrotonate tautomerase family enzyme - ALPH; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3ry0_A Putative tautomerase; oxalocrotonate tautomerase family, isomerase; 1.40A {Streptomyces achromogenes} Back     alignment and structure
>2x4k_A 4-oxalocrotonate tautomerase; isomerase; 1.10A {Staphylococcus aureus} Back     alignment and structure
>3ej9_A Alpha-subunit of trans-3-chloroacrylic acid dehal; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej3_A 1s0y_A 3ej7_A Back     alignment and structure
>3e6q_A Putative 5-carboxymethyl-2-hydroxymuconate isomer; structural genomics, APC7683, isomerase, PSI-2, protein STRU initiative; HET: GOL IMD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1otg_A 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A {Escherichia coli} SCOP: d.80.1.2 Back     alignment and structure
>3ej9_B Beta-subunit of trans-3-chloroacrylic acid dehalo; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej7_B 3ej3_B 1s0y_B Back     alignment and structure
>1gyx_A YDCE, B1461, hypothetical protein YDCE; tautomerase, isomerase, complete proteo; HET: EPE; 1.35A {Escherichia coli} SCOP: d.80.1.1 PDB: 1gyj_A* 1gyy_A* Back     alignment and structure
>3abf_A 4-oxalocrotonate tautomerase; isomerase; 1.94A {Thermus thermophilus} Back     alignment and structure
>2x4k_A 4-oxalocrotonate tautomerase; isomerase; 1.10A {Staphylococcus aureus} Back     alignment and structure
>3mb2_A 4-oxalocrotonate tautomerase family enzyme - ALPH; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3ej9_A Alpha-subunit of trans-3-chloroacrylic acid dehal; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej3_A 1s0y_A 3ej7_A Back     alignment and structure
>3n4h_A Putative tautomerase; CG10062, CIS-3-chloroacrylic acid dehalogenase, tautomerase superfamily, beta-alpha-beta motif, hydrolase; HET: PR7; 2.02A {Corynebacterium glutamicum} PDB: 3n4d_A* 3n4g_A Back     alignment and structure
>3m20_A 4-oxalocrotonate tautomerase, putative; DMPI, thermophIle, beta-alpha-beta, catalytic proline, isomerase; 2.37A {Archaeoglobus fulgidus} Back     alignment and structure
>2aal_A Malonate semialdehyde decarboxylase; tautomerase superfamily, beta-alpha-beta, homotrimeric, LYAS; 1.65A {Pseudomonas pavonaceae} SCOP: d.80.1.6 PDB: 2aag_A 2aaj_A Back     alignment and structure
>3mlc_A FG41 malonate semialdehyde decarboxylase; tautomerase superfamily, malonate semialdehyde decarboxylase alpha-beta-motif; 2.22A {Coryneform bacterium} SCOP: d.80.1.0 PDB: 3mjz_A Back     alignment and structure
>3c6v_A Probable tautomerase/dehalogenase AU4130; aspergillus fumigatus trimeric thermophilic probable tautomerase/dehalogenase; HET: MSE; 1.90A {Aspergillus fumigatus AF293} Back     alignment and structure
>3mb2_B 4-oxalocrotonate tautomerase family enzyme - beta; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3ry0_A Putative tautomerase; oxalocrotonate tautomerase family, isomerase; 1.40A {Streptomyces achromogenes} Back     alignment and structure
>3m21_A Probable tautomerase HP_0924; 4-oxalocrotonate tautomerase, catalytic proline, hexamer, BE beta, isomerase; 1.90A {Helicobacter pylori} PDB: 2orm_A Back     alignment and structure
>3mf7_A CIS-3-chloroacrylic acid dehalogenase; beta-alpha-beta motif, tautomerase, CIS-3-CHLO acid dehalogenase, isomerase, hydrolase; HET: PR4; 1.65A {Coryneform bacterium} PDB: 3mf8_A 2flt_A 2flz_A Back     alignment and structure
>2opa_A Probable tautomerase YWHB; homohexamer, 4-oxalocrotonate tautomerase, inhibitor, 2-FLUO hydroxycinnamate, isomerase; HET: FHC; 2.40A {Bacillus subtilis} PDB: 2op8_A* Back     alignment and structure
>1otf_A 4-oxalocrotonate tautomerase; isomerase; 1.90A {Pseudomonas SP} SCOP: d.80.1.1 PDB: 4otc_A 4ota_A 4otb_A 1bjp_A 2fm7_A Back     alignment and structure
>1mww_A Hypothetical protein HI1388.1; structural genomics, structure 2 function project, S2F, unknown function; HET: GLU; 2.08A {Haemophilus influenzae} SCOP: d.80.1.4 Back     alignment and structure
>3ej9_B Beta-subunit of trans-3-chloroacrylic acid dehalo; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej7_B 3ej3_B 1s0y_B Back     alignment and structure
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A* Back     alignment and structure
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major} Back     alignment and structure
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus} Back     alignment and structure
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3 Back     alignment and structure
>1gyx_A YDCE, B1461, hypothetical protein YDCE; tautomerase, isomerase, complete proteo; HET: EPE; 1.35A {Escherichia coli} SCOP: d.80.1.1 PDB: 1gyj_A* 1gyy_A* Back     alignment and structure
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3 Back     alignment and structure
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode,; 1.60A {Ancylostoma ceylanicum} PDB: 3rf4_A* 3rf5_A* Back     alignment and structure
>1u9d_A Hypothetical protein VC0714; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics; 1.70A {Vibrio cholerae o1 biovar eltor str} SCOP: d.80.1.5 Back     alignment and structure
>3t5s_A Gilaa.00834.A, macrophage migration inhibitory factor; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Giardia lamblia} Back     alignment and structure
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major} Back     alignment and structure
>4dh4_A MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} Back     alignment and structure
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major} Back     alignment and structure
>3djh_A Macrophage migration inhibitory factor; homotrimer, cytokine, inflammatory response, isomerase, phosphoprotein; 1.25A {Homo sapiens} SCOP: d.80.1.3 PDB: 1ca7_A* 1ljt_A* 2ooh_A* 2ooz_A* 3b9s_A* 2oow_A* 3ce4_A 3dji_A* 3ijg_A* 3ijj_A* 3smb_A* 3smc_A* 3u18_A* 4f2k_A* 1gd0_A* 1gcz_A* 3jsf_A* 3jsg_A* 3jtu_A* 3l5p_A* ... Back     alignment and structure
>3mb2_B 4-oxalocrotonate tautomerase family enzyme - beta; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3kan_A D-dopachrome tautomerase; immune response, cytokine, cytokine-inhibitor C; HET: RW1; 1.13A {Homo sapiens} SCOP: d.80.1.3 PDB: 1dpt_A* 3ker_A* Back     alignment and structure
>1otg_A 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A {Escherichia coli} SCOP: d.80.1.2 Back     alignment and structure
>1n91_A ORF, hypothetical protein; alpha+beta, northeast structural genomics consortium, PSI, P structure initiative, NESG; NMR {Escherichia coli} SCOP: d.206.1.1 PDB: 1yh5_A Back     alignment and structure
>2y9j_Y Lipoprotein PRGK, protein PRGK; protein transport, type III secretion, IR1, inner membrane R C24-fold; 6.40A {Salmonella enterica subsp} Back     alignment and structure
>3e6q_A Putative 5-carboxymethyl-2-hydroxymuconate isomer; structural genomics, APC7683, isomerase, PSI-2, protein STRU initiative; HET: GOL IMD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d1uiza_115 d.80.1.3 (A:) Microphage migration inhibition fact 3e-41
d1hfoa_113 d.80.1.3 (A:) Microphage migration inhibition fact 3e-40
d2gdga1114 d.80.1.3 (A:1-114) Microphage migration inhibition 5e-39
d1dpta_117 d.80.1.3 (A:) D-dopachrome tautomerase {Human (Hom 5e-37
>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 115 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Tautomerase/MIF
superfamily: Tautomerase/MIF
family: MIF-related
domain: Microphage migration inhibition factor (MIF)
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score =  130 bits (328), Expect = 3e-41
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 1   MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAY 60
           MP   I TNV  D V   ++LS+ T  +A   GKP  Y+ I +     MSFG + DP A 
Sbjct: 1   MPVFTIRTNVCRDSV-PDTLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAV 59

Query: 61  GELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKAHQ 107
             L SIG +    NK  +  +  IL K+L++P +R +I +YD  A  
Sbjct: 60  CSLCSIGKIGGPQNKSYTKLLCDILTKQLNIPANRVYINYYDLNAAN 106
>d1hfoa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]} Length = 113 Back     information, alignment and structure
>d2gdga1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1dpta_ d.80.1.3 (A:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1uiza_115 Microphage migration inhibition factor (MIF) {Afri 100.0
d2gdga1114 Microphage migration inhibition factor (MIF) {Mous 100.0
d1hfoa_113 Microphage migration inhibition factor (MIF) {Tric 100.0
d1dpta_117 D-dopachrome tautomerase {Human (Homo sapiens) [Ta 100.0
d1mwwa_120 Hypothetical protein HI1388.1 {Haemophilus influen 99.95
d2aala1129 Malonate semialdehyde decarboxylase, MSAD {Pseudom 99.92
d1otfa_59 4-oxalocrotonate tautomerase {Pseudomonas sp., Dmp 99.65
d1s0ya_62 Trans-3-chloroacrylic acid dehalogenase alpha-subu 99.61
d1gyxa_76 4-oxalocrotonate tautomerase homologue YdcE {Esche 99.14
d1otfa_59 4-oxalocrotonate tautomerase {Pseudomonas sp., Dmp 98.7
d1s0ya_62 Trans-3-chloroacrylic acid dehalogenase alpha-subu 98.65
d1u9da_122 Hypothetical protein VC0714 {Vibrio cholerae [TaxI 98.64
d2aala1129 Malonate semialdehyde decarboxylase, MSAD {Pseudom 98.6
d1otga_125 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) 98.3
d1gyxa_76 4-oxalocrotonate tautomerase homologue YdcE {Esche 98.08
d1mwwa_120 Hypothetical protein HI1388.1 {Haemophilus influen 97.99
d1s0yb_55 Trans-3-chloroacrylic acid dehalogenase beta-subun 97.33
d1hfoa_113 Microphage migration inhibition factor (MIF) {Tric 96.21
d2gdga1114 Microphage migration inhibition factor (MIF) {Mous 96.13
d1uiza_115 Microphage migration inhibition factor (MIF) {Afri 95.78
d1s0yb_55 Trans-3-chloroacrylic acid dehalogenase beta-subun 95.3
d1dpta_117 D-dopachrome tautomerase {Human (Homo sapiens) [Ta 94.17
d1u9da_122 Hypothetical protein VC0714 {Vibrio cholerae [TaxI 86.68
d1jwqa_179 N-acetylmuramoyl-L-alanine amidase CwlV {Paenibaci 82.03
>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Tautomerase/MIF
superfamily: Tautomerase/MIF
family: MIF-related
domain: Microphage migration inhibition factor (MIF)
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=100.00  E-value=1.3e-45  Score=236.41  Aligned_cols=115  Identities=35%  Similarity=0.561  Sum_probs=112.1

Q ss_pred             CCeEEEEeCCCCCCcChHHHHHHHHHHHHHHhCCCCcEEEEEEeCCceeeecCCCCCeeEEEEEeeeCCChhHHHHHHHH
Q 033334            1 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAA   80 (121)
Q Consensus         1 MP~i~i~tn~~~~~~~~~~~~~~l~~~~~~~~~kp~~~i~v~v~~~~~~~~gg~~~p~~~v~i~~~g~~~~e~~~~~~~~   80 (121)
                      ||+++|+||++.++. +++|++++++++|+++|||++++||++.++++|+|||+++||||++|+++|++++++|++++++
T Consensus         1 MP~i~i~TNv~~~~~-~~~~~~~ls~~ia~~lgKpe~~vmv~v~~~~~m~fggs~~P~a~~~v~siG~l~~~~n~~~s~~   79 (115)
T d1uiza_           1 MPVFTIRTNVCRDSV-PDTLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAVCSLCSIGKIGGPQNKSYTKL   79 (115)
T ss_dssp             CCEEEEEESSCGGGS-CTTHHHHHHHHHHHHHTCCGGGCEEEEECSCEEEETTBCSSCEEEEEEESSCCSHHHHHHHHHH
T ss_pred             CCeEEEEecCCchhC-hHHHHHHHHHHHHHHHCCCHHHEEEEEcCCceEEeCCCCCcEEEEEEEEEcCCChhhhHHHHHH
Confidence            999999999998765 7899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCCeEEEEEEeCCCCCceeCCceee
Q 033334           81 ISAILEKKLSVPKSRFFIKFYDTKAHQSREHAQCLH  116 (121)
Q Consensus        81 i~~~l~~~lgi~~~ri~i~f~~~~~~~~g~~G~~~~  116 (121)
                      |+++++++||||++||||.|+++++++|||||+||+
T Consensus        80 i~~~l~~~LgI~~~Riyi~f~d~~~~~~G~nG~TFA  115 (115)
T d1uiza_          80 LCDILTKQLNIPANRVYINYYDLNAANVGWNGSTFA  115 (115)
T ss_dssp             HHHHHHHHHCCCGGGEEEEEEECCGGGEEETTEECC
T ss_pred             HHHHHHHHcCCCcceEEEEEEECCHHHeeECcEECC
Confidence            999999999999999999999999999999999986
>d2gdga1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hfoa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]} Back     information, alignment and structure
>d1dpta_ d.80.1.3 (A:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2aala1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1otfa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase {Pseudomonas sp., DmpI [TaxId: 306]} Back     information, alignment and structure
>d1s0ya_ d.80.1.1 (A:) Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1gyxa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase homologue YdcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1otfa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase {Pseudomonas sp., DmpI [TaxId: 306]} Back     information, alignment and structure
>d1s0ya_ d.80.1.1 (A:) Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1u9da_ d.80.1.5 (A:) Hypothetical protein VC0714 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2aala1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1otga_ d.80.1.2 (A:) 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gyxa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase homologue YdcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s0yb_ d.80.1.1 (B:) Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1hfoa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]} Back     information, alignment and structure
>d2gdga1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1s0yb_ d.80.1.1 (B:) Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1dpta_ d.80.1.3 (A:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9da_ d.80.1.5 (A:) Hypothetical protein VC0714 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1jwqa_ c.56.5.6 (A:) N-acetylmuramoyl-L-alanine amidase CwlV {Paenibacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure