Citrus Sinensis ID: 033339


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVSSARMEEHGFESTTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERGIFKACHN
cHHHHHHHHHHccHHHHHHHHHHHcccccccccHHHcccccccccccccccccccHHHHHHHccccccccEEEEccccHHHHHHHHHHHccccEEEEEcccccccEEEEEEcHHHHHHHcc
*******FLSHGNIVKSAVLQRIRLVNPMLRPVV*******************TTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERGIFKA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVSSARMEEHGFESTTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERGIFKACHN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CBS domain-containing protein CBSX3, mitochondrial probableQ9LEV3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V8Q, chain E
Confidence level:very confident
Coverage over the Query: 53-120
View the alignment between query and template
View the model in PyMOL
Template: 3USB, chain A
Confidence level:confident
Coverage over the Query: 32-114
View the alignment between query and template
View the model in PyMOL