Citrus Sinensis ID: 033355

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-

MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIASGREKLASVPSGGGVAVAAAPSAGGAGAAPAAAEAKKEEKVEEKEESDDVRFTYLMPSIFYEPTF

cHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccc

MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIASGREKLA*******************************************RFTYLMPSIFYEPTF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIASGREKLASVPSGGGVAVAAAPSAGGAGAAPAAAEAKKEEKVEEKEESDDVRFTYLMPSIFYEPTF

Annotation	Function Description	Confidence Level	Reference Protein
60S acidic ribosomal protein P2-4	Plays an important role in the elongation step of protein synthesis.	probable	Q9LXM8
60S acidic ribosomal protein P2	Probable bifunctional protein. The phosphorylated protein plays an important role in the elongation step of protein synthesis (By similarity). The phosphopantetheinylated protein acts as an acyl carrier protein.	probable	Q96UQ7

No EC number assigned to the protein, probably not an enzyme!

Template: 2LBF, chain B
Confidence level:very confident
Coverage over the Query: 1-69
View the alignment between query and template
View the model in PyMOL

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3iz5, chain v		very confident	Alignment \| Template Structure