Citrus Sinensis ID: 033355
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| 255568554 | 108 | 60S acidic ribosomal protein P2, putativ | 0.603 | 0.675 | 0.849 | 6e-26 | |
| 448872696 | 112 | 60S acidic ribosomal protein P2B [Elaeis | 0.578 | 0.625 | 0.871 | 1e-25 | |
| 224105037 | 113 | predicted protein [Populus trichocarpa] | 0.578 | 0.619 | 0.857 | 3e-25 | |
| 42565379 | 114 | 60s acidic ribosomal protein [Hyacinthus | 0.570 | 0.605 | 0.884 | 4e-25 | |
| 388516419 | 115 | unknown [Lotus japonicus] | 0.628 | 0.660 | 0.763 | 2e-24 | |
| 147828208 | 110 | hypothetical protein VITISV_042772 [Viti | 0.867 | 0.954 | 0.733 | 2e-24 | |
| 24473796 | 113 | 60s acidic ribosomal protein [Prunus dul | 0.553 | 0.592 | 0.850 | 5e-24 | |
| 225440938 | 114 | PREDICTED: 60S acidic ribosomal protein | 0.553 | 0.587 | 0.850 | 1e-23 | |
| 47026878 | 114 | acidic ribosomal protein [Hyacinthus ori | 0.570 | 0.605 | 0.855 | 1e-23 | |
| 77416939 | 162 | unknown [Solanum tuberosum] | 0.677 | 0.506 | 0.670 | 2e-23 |
| >gi|255568554|ref|XP_002525251.1| 60S acidic ribosomal protein P2, putative [Ricinus communis] gi|223535548|gb|EEF37217.1| 60S acidic ribosomal protein P2, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 121 bits (303), Expect = 6e-26, Method: Compositional matrix adjust.
Identities = 62/73 (84%), Positives = 69/73 (94%)
Query: 1 MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIASGRE 60
MKVVAAYLLAVLG NTSPSAD+IK IL SVGADC+ +++ELLLS+V+GKDITELIASGRE
Sbjct: 1 MKVVAAYLLAVLGVNTSPSADNIKDILNSVGADCDGDKIELLLSQVEGKDITELIASGRE 60
Query: 61 KLASVPSGGGVAV 73
KLASVPSGGGVAV
Sbjct: 61 KLASVPSGGGVAV 73
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|448872696|gb|AGE46033.1| 60S acidic ribosomal protein P2B [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
| >gi|224105037|ref|XP_002313663.1| predicted protein [Populus trichocarpa] gi|118484510|gb|ABK94130.1| unknown [Populus trichocarpa] gi|118485202|gb|ABK94462.1| unknown [Populus trichocarpa] gi|118487376|gb|ABK95516.1| unknown [Populus trichocarpa] gi|118488119|gb|ABK95879.1| unknown [Populus trichocarpa] gi|222850071|gb|EEE87618.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|42565379|gb|AAS20966.1| 60s acidic ribosomal protein [Hyacinthus orientalis] | Back alignment and taxonomy information |
|---|
| >gi|388516419|gb|AFK46271.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|147828208|emb|CAN75514.1| hypothetical protein VITISV_042772 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|24473796|gb|AAL91663.1| 60s acidic ribosomal protein [Prunus dulcis] gi|111013714|gb|ABH03379.1| 60S acidic ribosomal protein [Prunus dulcis] | Back alignment and taxonomy information |
|---|
| >gi|225440938|ref|XP_002283025.1| PREDICTED: 60S acidic ribosomal protein P2B [Vitis vinifera] gi|297740089|emb|CBI30271.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|47026878|gb|AAT08664.1| acidic ribosomal protein [Hyacinthus orientalis] | Back alignment and taxonomy information |
|---|
| >gi|77416939|gb|ABA81865.1| unknown [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| TAIR|locus:2042062 | 115 | AT2G27710 [Arabidopsis thalian | 0.512 | 0.539 | 0.741 | 1.4e-18 | |
| TAIR|locus:2075993 | 111 | AT3G44590 [Arabidopsis thalian | 0.512 | 0.558 | 0.725 | 2.8e-18 | |
| ZFIN|ZDB-GENE-031018-2 | 115 | rplp2 "ribosomal protein, larg | 0.512 | 0.539 | 0.629 | 2e-15 | |
| ASPGD|ASPL0000000414 | 109 | AN5996 [Emericella nidulans (t | 0.512 | 0.568 | 0.629 | 6.9e-15 | |
| TAIR|locus:2098653 | 115 | AT3G28500 [Arabidopsis thalian | 0.512 | 0.539 | 0.564 | 1.4e-14 | |
| CGD|CAL0003308 | 111 | RPP2B [Candida albicans (taxid | 0.512 | 0.558 | 0.596 | 2.3e-14 | |
| UNIPROTKB|Q5ANH5 | 111 | RPP2B "Cytosolic ribosomal aci | 0.512 | 0.558 | 0.596 | 2.3e-14 | |
| POMBASE|SPBP8B7.06 | 110 | rpp201 "60S acidic ribosomal p | 0.512 | 0.563 | 0.564 | 6.2e-14 | |
| UNIPROTKB|F1RYZ0 | 115 | RPLP2 "60S acidic ribosomal pr | 0.512 | 0.539 | 0.596 | 7.9e-14 | |
| TAIR|locus:2042052 | 130 | AT2G27720 [Arabidopsis thalian | 0.512 | 0.476 | 0.571 | 7.9e-14 |
| TAIR|locus:2042062 AT2G27710 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 224 (83.9 bits), Expect = 1.4e-18, P = 1.4e-18
Identities = 46/62 (74%), Positives = 54/62 (87%)
Query: 1 MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIASGRE 60
MKVVAAYLLAVL G SP++ DIK ILGSVGA+ ED+++ELLL EVKGKD+ ELIA+GRE
Sbjct: 1 MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE 60
Query: 61 KL 62
KL
Sbjct: 61 KL 62
|
|
| TAIR|locus:2075993 AT3G44590 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031018-2 rplp2 "ribosomal protein, large P2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000000414 AN5996 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098653 AT3G28500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003308 RPP2B [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ANH5 RPP2B "Cytosolic ribosomal acidic protein P2B" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBP8B7.06 rpp201 "60S acidic ribosomal protein P2A subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RYZ0 RPLP2 "60S acidic ribosomal protein P2" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042052 AT2G27720 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 121 | |||
| PLN00138 | 113 | PLN00138, PLN00138, large subunit ribosomal protei | 4e-46 | |
| cd05833 | 109 | cd05833, Ribosomal_P2, Ribosomal protein P2 | 2e-39 | |
| PTZ00373 | 112 | PTZ00373, PTZ00373, 60S Acidic ribosomal protein P | 3e-25 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 5e-15 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 1e-14 | |
| cd04411 | 105 | cd04411, Ribosomal_P1_P2_L12p, Ribosomal protein P | 1e-12 | |
| cd05831 | 103 | cd05831, Ribosomal_P1, Ribosomal protein P1 | 7e-09 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-06 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 3e-05 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 5e-05 | |
| PTZ00135 | 310 | PTZ00135, PTZ00135, 60S acidic ribosomal protein P | 6e-04 |
| >gnl|CDD|165706 PLN00138, PLN00138, large subunit ribosomal protein LP2; Provisional | Back alignment and domain information |
|---|
Score = 144 bits (364), Expect = 4e-46
Identities = 89/105 (84%), Positives = 95/105 (90%)
Query: 1 MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIASGRE 60
MKVVAAYLLAVLGGNT PSA+D+K ILGSVGAD +D+R+ELLLSEVKGKDITELIASGRE
Sbjct: 1 MKVVAAYLLAVLGGNTCPSAEDLKDILGSVGADADDDRIELLLSEVKGKDITELIASGRE 60
Query: 61 KLASVPSGGGVAVAAAPSAGGAGAAPAAAEAKKEEKVEEKEESDD 105
KLASVPSGGGVAVAAA + GAA AAEAKKEEKVEEKEESDD
Sbjct: 61 KLASVPSGGGVAVAAAAAPAAGGAAAPAAEAKKEEKVEEKEESDD 105
|
Length = 113 |
| >gnl|CDD|100111 cd05833, Ribosomal_P2, Ribosomal protein P2 | Back alignment and domain information |
|---|
| >gnl|CDD|185582 PTZ00373, PTZ00373, 60S Acidic ribosomal protein P2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|100108 cd04411, Ribosomal_P1_P2_L12p, Ribosomal protein P1, P2, and L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100109 cd05831, Ribosomal_P1, Ribosomal protein P1 | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|240285 PTZ00135, PTZ00135, 60S acidic ribosomal protein P0; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| PTZ00373 | 112 | 60S Acidic ribosomal protein P2; Provisional | 100.0 | |
| PLN00138 | 113 | large subunit ribosomal protein LP2; Provisional | 100.0 | |
| KOG3449 | 112 | consensus 60S acidic ribosomal protein P2 [Transla | 100.0 | |
| cd05833 | 109 | Ribosomal_P2 Ribosomal protein P2. This subfamily | 100.0 | |
| cd04411 | 105 | Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and | 100.0 | |
| COG2058 | 109 | RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Tr | 99.96 | |
| PRK06402 | 106 | rpl12p 50S ribosomal protein L12P; Reviewed | 99.95 | |
| cd05831 | 103 | Ribosomal_P1 Ribosomal protein P1. This subfamily | 99.94 | |
| cd05832 | 106 | Ribosomal_L12p Ribosomal protein L12p. This subfam | 99.91 | |
| TIGR03685 | 105 | L21P_arch 50S ribosomal protein L12P. This model r | 99.91 | |
| KOG1762 | 114 | consensus 60s acidic ribosomal protein P1 [Transla | 99.9 | |
| PF00428 | 88 | Ribosomal_60s: 60s Acidic ribosomal protein; Inter | 99.84 | |
| PTZ00135 | 310 | 60S acidic ribosomal protein P0; Provisional | 98.56 | |
| PTZ00240 | 323 | 60S ribosomal protein P0; Provisional | 97.38 | |
| PRK06402 | 106 | rpl12p 50S ribosomal protein L12P; Reviewed | 96.4 | |
| cd04411 | 105 | Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and | 96.34 | |
| PRK04019 | 330 | rplP0 acidic ribosomal protein P0; Validated | 96.34 | |
| KOG3449 | 112 | consensus 60S acidic ribosomal protein P2 [Transla | 94.69 | |
| PTZ00373 | 112 | 60S Acidic ribosomal protein P2; Provisional | 94.68 | |
| COG2058 | 109 | RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Tr | 93.11 | |
| cd05832 | 106 | Ribosomal_L12p Ribosomal protein L12p. This subfam | 93.11 | |
| TIGR03685 | 105 | L21P_arch 50S ribosomal protein L12P. This model r | 92.06 | |
| cd05833 | 109 | Ribosomal_P2 Ribosomal protein P2. This subfamily | 91.63 | |
| cd05831 | 103 | Ribosomal_P1 Ribosomal protein P1. This subfamily | 91.25 | |
| PLN00138 | 113 | large subunit ribosomal protein LP2; Provisional | 87.18 |
| >PTZ00373 60S Acidic ribosomal protein P2; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-41 Score=241.23 Aligned_cols=108 Identities=53% Similarity=0.799 Sum_probs=84.4
Q ss_pred ChHHHHHHHHHhcCCCCCCHHHHHHHHHhcCCCcchhHHHHHHHHhCCCChHHHHHhhhhhhcccCCCCCcccccCCCCC
Q 033355 1 MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIASGREKLASVPSGGGVAVAAAPSAG 80 (121)
Q Consensus 1 MkyvaAYlLl~l~G~~~~Tae~I~kIl~AaGveVd~~~~~~f~~~L~gk~i~eLI~~G~~kl~sv~agg~a~aaaaaa~a 80 (121)
||||+||||++|+||.+||++||++||+++||+||++|+++|++.|+||||++||++|++||+|+ ||+++++++++++
T Consensus 3 MkyvaAYlL~~lgG~~~pTaddI~kIL~AaGveVd~~~~~l~~~~L~GKdI~ELIa~G~~kl~sv--gg~~~aa~a~a~~ 80 (112)
T PTZ00373 3 MKYVAAYLMCVLGGNENPTKKEVKNVLSAVNADVEDDVLDNFFKSLEGKTPHELIAAGMKKLQNI--GGGVAAAAAPAAG 80 (112)
T ss_pred hHHHHHHHHHHHcCCCCCCHHHHHHHHHHcCCCccHHHHHHHHHHHcCCCHHHHHHHhHHHHhcc--cCccccccccccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999 3332211111111
Q ss_pred CCCCCcchhhhhhhhhhhccccccccc-cccc
Q 033355 81 GAGAAPAAAEAKKEEKVEEKEESDDVR-FTYL 111 (121)
Q Consensus 81 ~~~~~~a~~~~~~e~k~eeeEE~ddDm-f~l~ 111 (121)
++++++++ ++++++|+||+||||||| ||||
T Consensus 81 ~~~~~~~~-~~~~e~k~ee~ee~ddDmgf~LF 111 (112)
T PTZ00373 81 AATAGAKA-EAKKEEKKEEEEEEEDDLGFSLF 111 (112)
T ss_pred ccccccch-hhhhhhccccccccccccccccc
Confidence 11122222 234444556667888899 9998
|
|
| >PLN00138 large subunit ribosomal protein LP2; Provisional | Back alignment and domain information |
|---|
| >KOG3449 consensus 60S acidic ribosomal protein P2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05833 Ribosomal_P2 Ribosomal protein P2 | Back alignment and domain information |
|---|
| >cd04411 Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and L12p | Back alignment and domain information |
|---|
| >COG2058 RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06402 rpl12p 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >cd05831 Ribosomal_P1 Ribosomal protein P1 | Back alignment and domain information |
|---|
| >cd05832 Ribosomal_L12p Ribosomal protein L12p | Back alignment and domain information |
|---|
| >TIGR03685 L21P_arch 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >KOG1762 consensus 60s acidic ribosomal protein P1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00428 Ribosomal_60s: 60s Acidic ribosomal protein; InterPro: IPR001813 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PTZ00135 60S acidic ribosomal protein P0; Provisional | Back alignment and domain information |
|---|
| >PTZ00240 60S ribosomal protein P0; Provisional | Back alignment and domain information |
|---|
| >PRK06402 rpl12p 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >cd04411 Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and L12p | Back alignment and domain information |
|---|
| >PRK04019 rplP0 acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >KOG3449 consensus 60S acidic ribosomal protein P2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00373 60S Acidic ribosomal protein P2; Provisional | Back alignment and domain information |
|---|
| >COG2058 RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05832 Ribosomal_L12p Ribosomal protein L12p | Back alignment and domain information |
|---|
| >TIGR03685 L21P_arch 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >cd05833 Ribosomal_P2 Ribosomal protein P2 | Back alignment and domain information |
|---|
| >cd05831 Ribosomal_P1 Ribosomal protein P1 | Back alignment and domain information |
|---|
| >PLN00138 large subunit ribosomal protein LP2; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 121 | ||||
| 3izr_v | 113 | Localization Of The Large Subunit Ribosomal Protein | 8e-17 | ||
| 2w1o_A | 70 | Nmr Structure Of Dimerization Domain Of Human Ribos | 2e-13 | ||
| 3izs_v | 106 | Localization Of The Large Subunit Ribosomal Protein | 2e-05 |
| >pdb|3IZR|VV Chain v, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 113 | Back alignment and structure |
|
| >pdb|2W1O|A Chain A, Nmr Structure Of Dimerization Domain Of Human Ribosomal Protein P2 Length = 70 | Back alignment and structure |
| >pdb|3IZS|VV Chain v, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 106 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| 3iz5_v | 113 | 60S acidic ribosomal protein P21 - P2 (L12P); euka | 100.0 | |
| 3izc_v | 106 | 60S acidic ribosomal protein (P2); eukaryotic ribo | 100.0 | |
| 3izc_t | 106 | 60S acidic ribosomal protein RPP11 (P1); eukaryoti | 99.98 | |
| 3iz5_t | 110 | 60S acidic ribosomal protein P11 - P1 (L12P); euka | 99.97 | |
| 2lbf_B | 70 | 60S acidic ribosomal protein P2; ribosome, stalk, | 99.95 | |
| 3a1y_A | 58 | 50S ribosomal protein P1 (L12P); stalk, helix SPIN | 99.85 | |
| 2lbf_A | 69 | 60S acidic ribosomal protein P1; ribosome, stalk, | 99.79 | |
| 3iz5_s | 319 | 60S acidic ribosomal protein P0 (L10P); eukaryotic | 98.44 | |
| 2zkr_g | 317 | 60S acidic ribosomal protein P0; protein-RNA compl | 98.36 | |
| 3u5i_q | 312 | A0, L10E, 60S acidic ribosomal protein P0; transla | 98.12 | |
| 3iz5_t | 110 | 60S acidic ribosomal protein P11 - P1 (L12P); euka | 92.53 | |
| 3iz5_v | 113 | 60S acidic ribosomal protein P21 - P2 (L12P); euka | 88.64 | |
| 3izc_t | 106 | 60S acidic ribosomal protein RPP11 (P1); eukaryoti | 88.62 | |
| 3j21_k | 339 | Acidic ribosomal protein P0 homolog; archaea, arch | 86.16 |
| >2lbf_B 60S acidic ribosomal protein P2; ribosome, stalk, P1/P2; NMR {Homo sapiens} PDB: 2w1o_A | Back alignment and structure |
|---|
| >3a1y_A 50S ribosomal protein P1 (L12P); stalk, helix SPIN, ribonucleoprotein; 2.13A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2lbf_A 60S acidic ribosomal protein P1; ribosome, stalk, P1/P2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2zkr_g 60S acidic ribosomal protein P0; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >3u5i_q A0, L10E, 60S acidic ribosomal protein P0; translation, ribosome, ribosomal R ribosomal protein, STM1; 3.00A {Saccharomyces cerevisiae} PDB: 4b6a_q 3izc_s 3izs_s 3j16_G* 3o5h_M 3jyw_8 | Back alignment and structure |
|---|
| >3j21_k Acidic ribosomal protein P0 homolog; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00