Citrus Sinensis ID: 033418

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MRLLTHNMLSSNIKGVANGFPLLIEVEKVIEKQVDFNPDFLKNIFPKIEWQALVQASRSMGYSELPEESPESSMLDSDDFLMKFHHLHLEEGALVCPETGRKFPVNKGIPNMLLHEDEV
ccccHHHHHHccccccccccccEEEcEEEEEEcccccHHHHHHHcccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccCEEccccccEEcccccccccccccccc
MRLLTHNMLSSNIKGVANGFPLLIEVEKVIEKQVDFNPDFLKNIFPKIEWQALVQASRSMGYSELPEE****SMLDSDDFLMKFHHLHLEEGALVCPETGRKFPVNKGIPNMLLHE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLLTHNMLSSNIKGVANGFPLLIEVEKVIEKQVDFNPDFLKNIFPKIEWQALVQASRSMGYSELPEESPESSMLDSDDFLMKFHHLHLEEGALVCPETGRKFPVNKGIPNMLLHEDEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TRM112-like protein At1g78190 probableQ9C9R3
Multifunctional methyltransferase subunit trm112 Together with mtq2, required for the methylation of eRF1 on 'Gln-182'. Together with trm11, required for the formation of 2-methylguanosine at position 10 in tRNA. Probably has additional functions.probableQ09723
tRNA methyltransferase 112 homolog Participates both in methylation of protein and tRNA species. The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species.probableQ2KIA2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J6A, chain A
Confidence level:very confident
Coverage over the Query: 1-119
View the alignment between query and template
View the model in PyMOL