Citrus Sinensis ID: 033434


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MLGLALGSKVTVLDAPYHDTQSFSFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED
cccccHHHHHHHccccccccccccEEEEEEEEEEcccccHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccEEEEEcHHHHHHHHHHHHHHHcccccccccc
****ALGSKVTVLDAPYHDTQSFSFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRY****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGLALGSKVTVLDAPYHDTQSFSFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chlorophyll(ide) b reductase NOL, chloroplastic Required for chlorophyll b degradation.probableQ84ST4
Chlorophyll(ide) b reductase NOL, chloroplastic Required for chlorophyll b degradation. Chlorophyll b, chlorophyllide b, pheophorbide b and pheophytin b can be used as substrates.probableQ8LEU3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TJR, chain A
Confidence level:probable
Coverage over the Query: 12-51,62-79
View the alignment between query and template
View the model in PyMOL