Citrus Sinensis ID: 033434

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MLGLALGSKVTVLDAPYHDTQSFSFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED
cccccHHHHHHHHcccccccccccEEEEEEEEEEccccHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccEEEEEcHHHHHHHHHHHHHHHcccccccccc
ccHHHHccEEEEccccccccccEEEEEHHHHHEEEccccHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHEEEccccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccc
mlglalgskvtvldapyhdtqsfsFFIFHFSsiivqpgmvttdllmsgattKQAKFFINVLAEPADVVAECLVPKIRsiaasgstkptYLRFLTGVKAYSQIFSRIAfgarrnryiled
MLGLALGSKVTVLDAPYHDTQSFSFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIrsiaasgstkptyLRFLTGVKaysqifsriafgarrnryiled
MLGLALGSKVTVLDAPYHDTQsfsffifhfssiiVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED
****ALGSKVTVLDAPYHDTQSFSFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYI***
***********************SFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIR***********YLRFLTGVKAYSQIFSRIAFGAR********
MLGLALGSKVTVLDAPYHDTQSFSFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED
MLGLALGSKVTVLDAPYHDTQSFSFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRY****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGLALGSKVTVLDAPYHDTQSFSFFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query119 2.2.26 [Sep-21-2011]
Q8LEU3348 Chlorophyll(ide) b reduct yes no 0.714 0.244 0.788 5e-35
Q84ST4343 Chlorophyll(ide) b reduct yes no 0.714 0.247 0.776 1e-33
Q5N800504 Probable chlorophyll(ide) no no 0.630 0.148 0.325 5e-05
Q93ZA0496 Probable chlorophyll(ide) no no 0.386 0.092 0.446 6e-05
>sp|Q8LEU3|NOL_ARATH Chlorophyll(ide) b reductase NOL, chloroplastic OS=Arabidopsis thaliana GN=NOL PE=2 SV=1 Back     alignment and function desciption
 Score =  145 bits (367), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 67/85 (78%), Positives = 78/85 (91%)

Query: 35  VQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLT 94
           + PGMVTTDLLMSGATTKQAKFFINVLAEPA+VVAE LVP IR+I ASGS KPTY+RFLT
Sbjct: 264 LSPGMVTTDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASGSMKPTYIRFLT 323

Query: 95  GVKAYSQIFSRIAFGARRNRYILED 119
           G+KAY++IFSR+A GAR+NRY+ E+
Sbjct: 324 GIKAYTKIFSRVALGARKNRYVTEE 348
Required for chlorophyll b degradation. Chlorophyll b, chlorophyllide b, pheophorbide b and pheophytin b can be used as substrates.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 9EC: 4
>sp|Q84ST4|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1 Back     alignment and function description
>sp|Q5N800|NYC1_ORYSJ Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Oryza sativa subsp. japonica GN=NYC1 PE=1 SV=1 Back     alignment and function description
>sp|Q93ZA0|NYC1_ARATH Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Arabidopsis thaliana GN=NYC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
225424993 345 PREDICTED: chlorophyll(ide) b reductase 0.714 0.246 0.858 1e-35
356556680 349 PREDICTED: chlorophyll(ide) b reductase 0.714 0.243 0.835 4e-35
449446317 352 PREDICTED: chlorophyll(ide) b reductase 0.714 0.241 0.823 4e-34
18414726 348 chlorophyll(ide) b reductase NOL [Arabid 0.714 0.244 0.788 2e-33
297806477 349 short-chain dehydrogenase/reductase fami 0.714 0.243 0.788 3e-33
15475687683 short-chain dehydrogenase/reductase fami 0.697 1.0 0.807 4e-33
75298085 343 RecName: Full=Chlorophyll(ide) b reducta 0.714 0.247 0.776 4e-32
326519666 346 predicted protein [Hordeum vulgare subsp 0.857 0.294 0.654 6e-32
345846651178 chlorophyll(ide) b reductase [Pyrus x br 0.672 0.449 0.837 7e-32
226532277 341 short-chain dehydrogenase/reductase SDR 0.714 0.249 0.752 3e-31
>gi|225424993|ref|XP_002266979.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Vitis vinifera] gi|297738201|emb|CBI27402.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/85 (85%), Positives = 79/85 (92%)

Query: 35  VQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLT 94
           + PGMVTTDLLMSGATTKQAKFFINVLAEPA+VVAE LVP IRSI  +GSTKPTY+RFLT
Sbjct: 261 LSPGMVTTDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPVNGSTKPTYIRFLT 320

Query: 95  GVKAYSQIFSRIAFGARRNRYILED 119
           G+KAYSQIFSR AFGARRNRY+LED
Sbjct: 321 GLKAYSQIFSRFAFGARRNRYLLED 345

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356556680|ref|XP_003546651.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449446317|ref|XP_004140918.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like [Cucumis sativus] gi|449494121|ref|XP_004159455.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18414726|ref|NP_568145.1| chlorophyll(ide) b reductase NOL [Arabidopsis thaliana] gi|75301367|sp|Q8LEU3.1|NOL_ARATH RecName: Full=Chlorophyll(ide) b reductase NOL, chloroplastic; AltName: Full=Protein NON-YELLOW COLORING 1-LIKE; Short=AtNOL; Short=Protein NYC1-LIKE; AltName: Full=Short-chain dehydrogenase/reductase NOL; Flags: Precursor gi|21553369|gb|AAM62462.1| unknown [Arabidopsis thaliana] gi|94442407|gb|ABF18991.1| At5g04900 [Arabidopsis thaliana] gi|134254417|dbj|BAF49742.1| short-chain dehydrogenase/reductase AtNOL1 [Arabidopsis thaliana] gi|332003419|gb|AED90802.1| chlorophyll(ide) b reductase NOL [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297806477|ref|XP_002871122.1| short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297316959|gb|EFH47381.1| short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|154756876|gb|ABS85189.1| short-chain dehydrogenase/reductase family protein, partial [Hypericum perforatum] Back     alignment and taxonomy information
>gi|75298085|sp|Q84ST4.1|NOL_ORYSJ RecName: Full=Chlorophyll(ide) b reductase NOL, chloroplastic; AltName: Full=Protein NON-YELLOW COLORING 1-LIKE; Short=OsNOL; Short=Protein NYC1-LIKE; AltName: Full=Short-chain dehydrogenase/reductase NOL; Flags: Precursor gi|29244639|gb|AAO73232.1| putative oxidoreductase protein [Oryza sativa Japonica Group] gi|50582763|gb|AAT78833.1| putative short chain dehydrogenase (having alternative splicing products) [Oryza sativa Japonica Group] gi|134254415|dbj|BAF49741.1| short-chain dehydrogenase/reductase NOL1 [Oryza sativa Japonica Group] gi|218193420|gb|EEC75847.1| hypothetical protein OsI_12846 [Oryza sativa Indica Group] gi|222625482|gb|EEE59614.1| hypothetical protein OsJ_11943 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|326519666|dbj|BAK00206.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|345846651|gb|AEO19897.1| chlorophyll(ide) b reductase [Pyrus x bretschneideri] Back     alignment and taxonomy information
>gi|226532277|ref|NP_001146883.1| short-chain dehydrogenase/reductase SDR [Zea mays] gi|195604660|gb|ACG24160.1| short-chain dehydrogenase/reductase SDR [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
TAIR|locus:2175254348 NOL "NYC1-like" [Arabidopsis t 0.714 0.244 0.788 6e-32
UNIPROTKB|Q84ST4343 NOL "Chlorophyll(ide) b reduct 0.714 0.247 0.776 4.2e-31
UNIPROTKB|Q5N800504 NYC1 "Probable chlorophyll(ide 0.630 0.148 0.325 3.6e-05
TAIR|locus:2119330496 NYC1 "NON-YELLOW COLORING 1" [ 0.386 0.092 0.446 5.8e-05
TAIR|locus:2175254 NOL "NYC1-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 350 (128.3 bits), Expect = 6.0e-32, P = 6.0e-32
 Identities = 67/85 (78%), Positives = 78/85 (91%)

Query:    35 VQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLT 94
             + PGMVTTDLLMSGATTKQAKFFINVLAEPA+VVAE LVP IR+I ASGS KPTY+RFLT
Sbjct:   264 LSPGMVTTDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASGSMKPTYIRFLT 323

Query:    95 GVKAYSQIFSRIAFGARRNRYILED 119
             G+KAY++IFSR+A GAR+NRY+ E+
Sbjct:   324 GIKAYTKIFSRVALGARKNRYVTEE 348
GO:0000166 "nucleotide binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=TAS
GO:0015996 "chlorophyll catabolic process" evidence=IDA
GO:0034256 "chlorophyll(ide) b reductase activity" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|Q84ST4 NOL "Chlorophyll(ide) b reductase NOL, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q5N800 NYC1 "Probable chlorophyll(ide) b reductase NYC1, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2119330 NYC1 "NON-YELLOW COLORING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84ST4NOL_ORYSJ1, ., 1, ., 1, ., 2, 9, 40.77640.71420.2478yesno
Q8LEU3NOL_ARATH1, ., 1, ., 1, ., 2, 9, 40.78820.71420.2442yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 119
PRK05599246 hypothetical protein; Provisional 95.3
COG0300265 DltE Short-chain dehydrogenases of various substra 95.14
PRK07832272 short chain dehydrogenase; Provisional 94.58
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 93.87
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.32
PLN02780320 ketoreductase/ oxidoreductase 92.01
PRK05855582 short chain dehydrogenase; Validated 91.32
PRK05693274 short chain dehydrogenase; Provisional 91.01
PRK07478254 short chain dehydrogenase; Provisional 90.68
PRK05650270 short chain dehydrogenase; Provisional 90.66
PRK12937245 short chain dehydrogenase; Provisional 90.39
PRK05866293 short chain dehydrogenase; Provisional 90.16
PRK06179270 short chain dehydrogenase; Provisional 90.07
PRK12747252 short chain dehydrogenase; Provisional 89.86
PRK07831262 short chain dehydrogenase; Provisional 89.42
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 89.35
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 88.98
PRK06139330 short chain dehydrogenase; Provisional 88.41
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 88.3
PRK06841255 short chain dehydrogenase; Provisional 88.26
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 88.25
PRK06924251 short chain dehydrogenase; Provisional 87.92
PRK06940275 short chain dehydrogenase; Provisional 87.58
PRK05993277 short chain dehydrogenase; Provisional 87.52
PRK08177225 short chain dehydrogenase; Provisional 87.32
PRK07024257 short chain dehydrogenase; Provisional 87.01
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 86.06
PRK06947248 glucose-1-dehydrogenase; Provisional 86.0
PRK08226263 short chain dehydrogenase; Provisional 85.92
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 85.84
PRK07904253 short chain dehydrogenase; Provisional 85.53
PRK07063260 short chain dehydrogenase; Provisional 85.48
PRK08017256 oxidoreductase; Provisional 85.44
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 85.42
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 85.39
PRK07035252 short chain dehydrogenase; Provisional 85.14
PRK06172253 short chain dehydrogenase; Provisional 85.02
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 84.62
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 84.44
PRK08936261 glucose-1-dehydrogenase; Provisional 84.11
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 83.94
PRK06114254 short chain dehydrogenase; Provisional 83.75
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 83.41
PRK07814263 short chain dehydrogenase; Provisional 82.91
PRK06182273 short chain dehydrogenase; Validated 82.64
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.48
PRK06398258 aldose dehydrogenase; Validated 82.31
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 82.2
PRK06101240 short chain dehydrogenase; Provisional 82.17
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 81.74
PRK07069251 short chain dehydrogenase; Validated 81.47
PRK05867253 short chain dehydrogenase; Provisional 81.37
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 80.96
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.37
PRK07201657 short chain dehydrogenase; Provisional 80.04
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information 
Probab=95.30  E-value=0.035  Score=42.18  Aligned_cols=64  Identities=22%  Similarity=0.281  Sum_probs=42.5

Q ss_pred             cceeeccccCCccc----ce------eeeeceeeeecccchhhhhhhhcCCChHHHHHHHHHhCCChHHHHHHHHHHHHh
Q 033434            9 KVTVLDAPYHDTQS----FS------FFIFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRS   78 (119)
Q Consensus         9 ~~~~~~~~~~~t~~----~~------~~~~~~~~gtLSPGMV~TDLL~~~a~~~~~K~ffNiLaE~pEtVA~~LVprIr~   78 (119)
                      ...|-.++|+.+|.    |.      +....+-|..++||+|.|++... ... .     . +..+||+||+.++.-+..
T Consensus       142 ~~~~~~~~Y~asKaa~~~~~~~la~el~~~~I~v~~v~PG~v~T~~~~~-~~~-~-----~-~~~~pe~~a~~~~~~~~~  213 (246)
T PRK05599        142 RARRANYVYGSTKAGLDAFCQGLADSLHGSHVRLIIARPGFVIGSMTTG-MKP-A-----P-MSVYPRDVAAAVVSAITS  213 (246)
T ss_pred             cCCcCCcchhhHHHHHHHHHHHHHHHhcCCCceEEEecCCcccchhhcC-CCC-C-----C-CCCCHHHHHHHHHHHHhc
Confidence            34456678999982    11      12234888899999999998532 211 1     0 125899999999988776


Q ss_pred             hh
Q 033434           79 IA   80 (119)
Q Consensus        79 ~~   80 (119)
                      .+
T Consensus       214 ~~  215 (246)
T PRK05599        214 SK  215 (246)
T ss_pred             CC
Confidence            43

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 92.12
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 91.97
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 91.59
3tjr_A301 Short chain dehydrogenase; structural genomics, se 91.51
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 91.13
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 91.08
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 90.3
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 90.2
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 90.19
4eso_A255 Putative oxidoreductase; NADP, structural genomics 89.96
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 89.71
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 89.37
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 89.32
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 89.04
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 88.89
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 88.85
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 88.75
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 88.69
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 88.67
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 88.53
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 88.25
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 88.05
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 88.01
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 87.97
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 87.84
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 87.75
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 87.44
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 87.44
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 87.43
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 87.18
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 87.1
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 87.0
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 86.67
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 86.47
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 86.44
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 86.19
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 85.77
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 85.71
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 85.69
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 85.61
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 85.6
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 85.41
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 85.38
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 85.29
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 84.9
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 84.42
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 83.96
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 83.8
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 83.55
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 83.48
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 83.0
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 82.98
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 82.9
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 82.49
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 82.48
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 82.43
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 82.26
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 82.17
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 81.99
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 81.96
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 81.7
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 81.49
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 81.19
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 80.94
4e4y_A244 Short chain dehydrogenase family protein; structur 80.64
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 80.57
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 80.45
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 80.39
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
Probab=92.12  E-value=0.047  Score=40.76  Aligned_cols=63  Identities=13%  Similarity=0.169  Sum_probs=30.4

Q ss_pred             eeccccCCccc----ceee------eeceeeeecccchhhhhhhhcCCChHHHHHHHHHh----CCChHHHHHHHHH
Q 033434           12 VLDAPYHDTQS----FSFF------IFHFSSIIVQPGMVTTDLLMSGATTKQAKFFINVL----AEPADVVAECLVP   74 (119)
Q Consensus        12 ~~~~~~~~t~~----~~~~------~~~~~~gtLSPGMV~TDLL~~~a~~~~~K~ffNiL----aE~pEtVA~~LVp   74 (119)
                      +-.++|+.+|.    |.-.      ...+-|..++||+|.|++.......+..+.+....    .-+||.||+.++-
T Consensus       156 ~~~~~Y~asKaa~~~l~~~la~e~~~~gi~vn~v~PG~v~T~~~~~~~~~~~~~~~~~~~~~~r~~~pedvA~~v~~  232 (262)
T 3ksu_A          156 GFYSTYAGNKAPVEHYTRAASKELMKQQISVNAIAPGPMDTSFFYGQETKESTAFHKSQAMGNQLTKIEDIAPIIKF  232 (262)
T ss_dssp             CCCCC-----CHHHHHHHHHHHHTTTTTCEEEEEEECCCCTHHHHTCC------------CCCCSCCGGGTHHHHHH
T ss_pred             CCCchhHHHHHHHHHHHHHHHHHHHHcCcEEEEEeeCCCcCccccccCchHHHHHHHhcCcccCCCCHHHHHHHHHH
Confidence            44568999982    2221      22478899999999999986644322222221111    1367888876554
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 96.9
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 95.35
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 94.92
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 94.73
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 93.81
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 93.63
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 93.07
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 92.95
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 92.57
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 92.56
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 92.38
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 92.18
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 91.99
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 91.97
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 91.65
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 91.61
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 91.42
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 91.15
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 91.1
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 90.8
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 90.71
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 90.48
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.2
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 90.14
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 90.06
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 89.72
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 88.82
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 88.72
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 88.32
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 88.2
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 88.04
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 87.93
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 87.86
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 87.77
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 87.57
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 86.76
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 86.52
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 86.21
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 85.69
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 85.35
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 84.89
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 84.74
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 84.15
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 84.04
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 83.35
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 82.71
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 82.1
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 81.9
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 81.67
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 80.96
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 80.52
d2bnma171 Hydroxypropylphosphonic acid epoxidase Fom4, N-ter 80.34
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 80.14
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Human estrogenic 17beta-hydroxysteroid dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.90  E-value=0.00018  Score=53.98  Aligned_cols=89  Identities=17%  Similarity=0.179  Sum_probs=50.2

Q ss_pred             ceeeccccCCcc----cceee------eeceeeeecccchhhhhhhhcCCC----------hHHHHHHHH----------
Q 033434           10 VTVLDAPYHDTQ----SFSFF------IFHFSSIIVQPGMVTTDLLMSGAT----------TKQAKFFIN----------   59 (119)
Q Consensus        10 ~~~~~~~~~~t~----~~~~~------~~~~~~gtLSPGMV~TDLL~~~a~----------~~~~K~ffN----------   59 (119)
                      ..|-.++|+.+|    +|+-.      ...+-|..++||+|.|+++..-..          ....+++..          
T Consensus       148 ~~~~~~~Y~asKaal~~l~~~la~El~~~gIrVn~V~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  227 (285)
T d1jtva_         148 GLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFR  227 (285)
T ss_dssp             CCTTCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEECCBCC-------CCHHHHHHTSCHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCchHHHHHHHHHHHHHHHHHHHhhccCcEEEEEecCCCCChHHHHhccCHHHHhhccchhHHHHHHHHHHHHhhhhc
Confidence            345567899988    33322      234889999999999998754321          112222322          


Q ss_pred             HhCCChHHHHHHHHHHHHhhhccCCCCCeeeEEeChHHHHHHHHHH
Q 033434           60 VLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSR  105 (119)
Q Consensus        60 iLaE~pEtVA~~LVprIr~~~~~g~~~~~~I~~LTp~kal~kif~R  105 (119)
                      --.-+||.||+.++.-+.+.  +.     .++|+|+.+.+.-+..|
T Consensus       228 ~~~~~PeeVA~~v~~~~~~~--~p-----~~ry~~g~~~~~~~~~~  266 (285)
T d1jtva_         228 EAAQNPEEVAEVFLTALRAP--KP-----TLRYFTTERFLPLLRMR  266 (285)
T ss_dssp             HHCBCHHHHHHHHHHHHHCS--SC-----CSEEESCSTTHHHHHHH
T ss_pred             ccCCCHHHHHHHHHHHHhCC--CC-----CeEEecHHHHHHHHHHH
Confidence            23457999999877654432  22     37899987654444333
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnma1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure