Citrus Sinensis ID: 033436

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MASLLQSLLDPKKNWLAAQHMKTISKRLRNFGLRYDDLYDPYYDLDIKEALDRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRNYLQDMLALVSILEIYIYVYRFYCASFS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHcccccccccHHHHHHHHcccHHHHHHHHHHHHHHHcHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccc
******SLLDPKKNWLAAQHMKTISKRLRNFGLRYDDLYDPYYDLDIKEALDRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRNYLQDMLALVSILEIYIYVYRFYCAS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLLQSLLDPKKNWLAAQHMKTISKRLRNFGLRYDDLYDPYYDLDIKEALDRLPREIVDARNQRLKRAMDLSMKHEYLPEDLQAMQTPFRNYLQDMLALVSILEIYIYVYRFYCASFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome b-c1 complex subunit 7-1 This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.confidentQ9SUU5
Cytochrome b-c1 complex subunit 7 This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.probableP48502
Cytochrome b-c1 complex subunit 7-2 This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.probableF4JWS8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CX5, chain G
Confidence level:very confident
Coverage over the Query: 8-105
View the alignment between query and template
View the model in PyMOL