Citrus Sinensis ID: 033474


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MNATYDTPRRLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY
ccccccccccccHHHHHHHHHHHHHHHHHccEEEEEEEccccccccEEEEcccccEEEEEEEccEEEEEEccccccEEEEEccccHHHHHHHHHHHHHHHcccEEEEccccccccccc
*******PRRLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYS*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNATYDTPRRLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin-like protein 4A Essential role in pre-mRNA splicing.probableP83876
Mitosis protein dim1 Plays a fundamental role as a protein essential for entry into mitosis (G2/M progression) as well as for chromosome segregation during mitosis. May play a role in mitotic spindle formation and/or function. May have a role in the maintenance or establishment of the steady-state level of the APC complex.probableP87215
Thioredoxin-like protein 4A Essential role in pre-mRNA splicing.probableP83877

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QGV, chain A
Confidence level:very confident
Coverage over the Query: 11-114
View the alignment between query and template
View the model in PyMOL