Citrus Sinensis ID: 033474

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MNATYDTPRRLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY
ccccccccccccHHHHHHHHHHHHHHHHHccEEEEEEEccccccccEEEEcccccEEEEEEEccEEEEEEccccccEEEEEccccHHHHHHHHHHHHHHHcccEEEEccccccccccc
ccccccccHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHEEcccccEEEEEEcccEEEEEccccccccEEEEcccHHHHHHHHHHHHHHHHcccEEEEccccccccccc
MNATYDTPRRLILNLEMDEVLSSVAETIKNFAVIYLVdisevpdfntmyelydpstvmffFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGArkgrglviapkdystkyry
mnatydtprrlILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVyrgarkgrglviapkdystkyry
MNATYDTPRRLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY
*********RLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAP*********
*******PRRLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYS*****
MNATYDTPRRLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY
***TYDTPRRLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYST****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNATYDTPRRLILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
P83877142 Thioredoxin-like protein yes no 0.881 0.732 0.846 1e-49
P83876142 Thioredoxin-like protein yes no 0.881 0.732 0.846 1e-49
P87215142 Mitosis protein dim1 OS=S yes no 0.881 0.732 0.740 6e-43
Q553S5160 Thioredoxin-like protein yes no 0.881 0.65 0.663 7e-40
Q06819143 Spliceosomal protein DIB1 yes no 0.838 0.692 0.666 8e-36
Q75BD8143 Spliceosomal protein DIB1 yes no 0.906 0.748 0.590 4e-34
Q6FMI2142 Spliceosomal protein DIB1 yes no 0.838 0.697 0.626 2e-33
Q9NX01149 Thioredoxin-like protein no no 0.813 0.644 0.377 4e-15
Q8BUH1149 Thioredoxin-like protein no no 0.813 0.644 0.377 2e-14
>sp|P83877|TXN4A_MOUSE Thioredoxin-like protein 4A OS=Mus musculus GN=Txnl4a PE=2 SV=1 Back     alignment and function desciption
 Score =  194 bits (493), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 88/104 (84%), Positives = 99/104 (95%)

Query: 15  LEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGN 74
           ++MDEVL S+AE +KNFAVIYLVDI+EVPDFN MYELYDP TVMFFFRNKHIMIDLGTGN
Sbjct: 39  MKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGN 98

Query: 75  NNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 118
           NNKINWA++DKQE +DI+ETVYRGARKGRGLV++PKDYSTKYRY
Sbjct: 99  NNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY 142
Essential role in pre-mRNA splicing.
Mus musculus (taxid: 10090)
>sp|P83876|TXN4A_HUMAN Thioredoxin-like protein 4A OS=Homo sapiens GN=TXNL4A PE=1 SV=1 Back     alignment and function description
>sp|P87215|DIMI_SCHPO Mitosis protein dim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dim1 PE=1 SV=1 Back     alignment and function description
>sp|Q553S5|TXN4A_DICDI Thioredoxin-like protein 4A homolog OS=Dictyostelium discoideum GN=txnl4a PE=3 SV=4 Back     alignment and function description
>sp|Q06819|DIB1_YEAST Spliceosomal protein DIB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIB1 PE=1 SV=1 Back     alignment and function description
>sp|Q75BD8|DIB1_ASHGO Spliceosomal protein DIB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DIB1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FMI2|DIB1_CANGA Spliceosomal protein DIB1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIB1 PE=3 SV=1 Back     alignment and function description
>sp|Q9NX01|TXN4B_HUMAN Thioredoxin-like protein 4B OS=Homo sapiens GN=TXNL4B PE=1 SV=1 Back     alignment and function description
>sp|Q8BUH1|TXN4B_MOUSE Thioredoxin-like protein 4B OS=Mus musculus GN=Txnl4b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
102139934191 spliceosomal U5 snRNP-specific 15 kDa pr 0.915 0.565 0.935 1e-53
297806863142 hypothetical protein ARALYDRAFT_908777 [ 0.881 0.732 0.961 2e-53
218184781 274 hypothetical protein OsI_34094 [Oryza sa 0.881 0.379 0.951 3e-53
224094081142 predicted protein [Populus trichocarpa] 0.881 0.732 0.961 4e-53
357466489142 Thioredoxin-like 4A [Medicago truncatula 0.881 0.732 0.951 4e-53
357439853142 Thioredoxin-like 4A [Medicago truncatula 0.881 0.732 0.951 4e-53
32493106137 putative DIM-like protein [Glycine max] 0.881 0.759 0.961 5e-53
15241574142 mRNA splicing factor, thioredoxin-like U 0.881 0.732 0.951 5e-53
449451739142 PREDICTED: thioredoxin-like protein 4A-l 0.881 0.732 0.951 6e-53
449460616142 PREDICTED: thioredoxin-like protein 4A-l 0.881 0.732 0.951 6e-53
>gi|102139934|gb|ABF70077.1| spliceosomal U5 snRNP-specific 15 kDa protein, putative [Musa acuminata] Back     alignment and taxonomy information
 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 101/108 (93%), Positives = 105/108 (97%)

Query: 11  LILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDL 70
            I  ++MDEVL+SVAETIKNFAVIYLVDI+EVPDFNTMYELYDPSTVMFFFRNKHIMIDL
Sbjct: 84  CIFVVQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDL 143

Query: 71  GTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 118
           GTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY
Sbjct: 144 GTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 191

Source: Musa acuminata

Species: Musa acuminata

Genus: Musa

Family: Musaceae

Order: Zingiberales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297806863|ref|XP_002871315.1| hypothetical protein ARALYDRAFT_908777 [Arabidopsis lyrata subsp. lyrata] gi|297317152|gb|EFH47574.1| hypothetical protein ARALYDRAFT_908777 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|218184781|gb|EEC67208.1| hypothetical protein OsI_34094 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|224094081|ref|XP_002310072.1| predicted protein [Populus trichocarpa] gi|225432821|ref|XP_002283622.1| PREDICTED: thioredoxin-like protein 4A [Vitis vinifera] gi|255577696|ref|XP_002529724.1| mitosis protein dim1, putative [Ricinus communis] gi|356532239|ref|XP_003534681.1| PREDICTED: DIM protein [Glycine max] gi|356571707|ref|XP_003554015.1| PREDICTED: thioredoxin-like protein 4A-like [Glycine max] gi|118484553|gb|ABK94150.1| unknown [Populus trichocarpa] gi|222852975|gb|EEE90522.1| predicted protein [Populus trichocarpa] gi|223530788|gb|EEF32653.1| mitosis protein dim1, putative [Ricinus communis] gi|255629203|gb|ACU14946.1| unknown [Glycine max] gi|297737123|emb|CBI26324.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357466489|ref|XP_003603529.1| Thioredoxin-like 4A [Medicago truncatula] gi|217069812|gb|ACJ83266.1| unknown [Medicago truncatula] gi|355492577|gb|AES73780.1| Thioredoxin-like 4A [Medicago truncatula] gi|388516725|gb|AFK46424.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357439853|ref|XP_003590204.1| Thioredoxin-like 4A [Medicago truncatula] gi|116782603|gb|ABK22569.1| unknown [Picea sitchensis] gi|116782987|gb|ABK22751.1| unknown [Picea sitchensis] gi|355479252|gb|AES60455.1| Thioredoxin-like 4A [Medicago truncatula] Back     alignment and taxonomy information
>gi|32493106|gb|AAP85544.1| putative DIM-like protein [Glycine max] Back     alignment and taxonomy information
>gi|15241574|ref|NP_196446.1| mRNA splicing factor, thioredoxin-like U5 snRNP [Arabidopsis thaliana] gi|11692866|gb|AAG40036.1|AF324685_1 AT5g08290 [Arabidopsis thaliana] gi|11908020|gb|AAG41439.1|AF326857_1 unknown protein [Arabidopsis thaliana] gi|12642840|gb|AAK00362.1|AF339680_1 unknown protein [Arabidopsis thaliana] gi|14030633|gb|AAK52991.1|AF375407_1 AT5g08290/F8L15_20 [Arabidopsis thaliana] gi|10178271|emb|CAC08329.1| putative protein [Arabidopsis thaliana] gi|13122294|dbj|BAB32888.1| Dim1 homolog [Arabidopsis thaliana] gi|17978897|gb|AAL47418.1| AT5g08290/F8L15_20 [Arabidopsis thaliana] gi|332003895|gb|AED91278.1| mRNA splicing factor, thioredoxin-like U5 snRNP [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449451739|ref|XP_004143618.1| PREDICTED: thioredoxin-like protein 4A-like [Cucumis sativus] gi|449516465|ref|XP_004165267.1| PREDICTED: thioredoxin-like protein 4A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449460616|ref|XP_004148041.1| PREDICTED: thioredoxin-like protein 4A-like [Cucumis sativus] gi|317159581|gb|ADV04065.1| mitosis protein YLS8 [Hevea brasiliensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
TAIR|locus:2150768142 YLS8 "AT5G08290" [Arabidopsis 0.881 0.732 0.951 8.3e-51
UNIPROTKB|E1C1X5142 TXNL4A "Uncharacterized protei 0.881 0.732 0.855 1.1e-46
UNIPROTKB|F1MTU6142 TXNL4A "Uncharacterized protei 0.881 0.732 0.855 1.1e-46
UNIPROTKB|E2R204142 TXNL4A "Uncharacterized protei 0.881 0.732 0.855 1.1e-46
UNIPROTKB|F1RZA0142 TXNL4A "Uncharacterized protei 0.881 0.732 0.855 1.1e-46
UNIPROTKB|P83876142 TXNL4A "Thioredoxin-like prote 0.881 0.732 0.846 1.4e-46
ZFIN|ZDB-GENE-041010-25142 txnl4a "thioredoxin-like 4A" [ 0.881 0.732 0.855 2.3e-46
FB|FBgn0031601142 Dim1 "Dim1" [Drosophila melano 0.881 0.732 0.855 3e-46
GENEDB_PFALCIPARUM|PFL1520w139 PFL1520w "dim1 protein homolog 0.881 0.748 0.798 1.3e-43
ASPGD|ASPL0000039933143 AN2848 [Emericella nidulans (t 0.881 0.727 0.75 1.5e-42
TAIR|locus:2150768 YLS8 "AT5G08290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 528 (190.9 bits), Expect = 8.3e-51, P = 8.3e-51
 Identities = 99/104 (95%), Positives = 104/104 (100%)

Query:    15 LEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGN 74
             ++MDEVL+SVAETIKNFAVIYLVDI+EVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGN
Sbjct:    39 MQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGN 98

Query:    75 NNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 118
             NNKINWALKDKQEFIDI+ETVYRGARKGRGLVIAPKDYSTKYRY
Sbjct:    99 NNKINWALKDKQEFIDIIETVYRGARKGRGLVIAPKDYSTKYRY 142
GO:0003824 "catalytic activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0007067 "mitosis" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=IDA
GO:0000902 "cell morphogenesis" evidence=RCA
GO:0006623 "protein targeting to vacuole" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0007033 "vacuole organization" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0016192 "vesicle-mediated transport" evidence=RCA
GO:0016197 "endosomal transport" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
UNIPROTKB|E1C1X5 TXNL4A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTU6 TXNL4A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R204 TXNL4A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZA0 TXNL4A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P83876 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-25 txnl4a "thioredoxin-like 4A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0031601 Dim1 "Dim1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFL1520w PFL1520w "dim1 protein homolog, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
ASPGD|ASPL0000039933 AN2848 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q75BD8DIB1_ASHGONo assigned EC number0.59090.90670.7482yesno
P83876TXN4A_HUMANNo assigned EC number0.84610.88130.7323yesno
Q06819DIB1_YEASTNo assigned EC number0.66660.83890.6923yesno
Q553S5TXN4A_DICDINo assigned EC number0.66340.88130.65yesno
Q6FMI2DIB1_CANGANo assigned EC number0.62620.83890.6971yesno
P87215DIMI_SCHPONo assigned EC number0.74030.88130.7323yesno
P83877TXN4A_MOUSENo assigned EC number0.84610.88130.7323yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
OsI_34094
Os10g0486600 (274 aa)
(Oryza sativa Indica)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
PLN00410142 PLN00410, PLN00410, U5 snRNP protein, DIM1 family; 6e-72
pfam02966133 pfam02966, DIM1, Mitosis protein DIM1 6e-65
cd02954114 cd02954, DIM1, Dim1 family; Dim1 is also referred 1e-51
cd02986114 cd02986, DLP, Dim1 family, Dim1-like protein (DLP) 3e-19
>gnl|CDD|215109 PLN00410, PLN00410, U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information 
 Score =  210 bits (537), Expect = 6e-72
 Identities = 98/104 (94%), Positives = 103/104 (99%)

Query: 15  LEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGN 74
           ++MDEVL+SVAETIKNFAVIYLVDI+EVPDFNTMYELYDP TVMFFFRNKHIMIDLGTGN
Sbjct: 39  MQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPCTVMFFFRNKHIMIDLGTGN 98

Query: 75  NNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 118
           NNKINWALKDKQEFIDIVETVYRGARKGRGLVI+PKDYSTKYRY
Sbjct: 99  NNKINWALKDKQEFIDIVETVYRGARKGRGLVISPKDYSTKYRY 142

Length = 142
>gnl|CDD|190488 pfam02966, DIM1, Mitosis protein DIM1 Back     alignment and domain information
>gnl|CDD|239252 cd02954, DIM1, Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>gnl|CDD|239284 cd02986, DLP, Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 100.0
KOG3414142 consensus Component of the U4/U6.U5 snRNP/mitosis 100.0
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 100.0
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 100.0
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.86
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 97.31
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 97.09
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 96.5
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 96.01
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 95.99
cd0294793 TRX_family TRX family; composed of two groups: Gro 95.97
PRK10996139 thioredoxin 2; Provisional 95.8
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 95.49
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 95.4
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 95.35
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 95.33
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 95.3
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 95.05
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 94.98
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 94.89
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 94.64
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 94.48
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 94.45
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 94.39
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 94.28
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 94.26
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 94.24
cd02962152 TMX2 TMX2 family; composed of proteins similar to 94.23
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 93.36
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 93.35
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 93.15
PRK09381109 trxA thioredoxin; Provisional 93.11
PTZ00443224 Thioredoxin domain-containing protein; Provisional 92.94
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 92.85
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 92.65
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 92.65
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 92.55
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 92.51
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 91.3
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 91.06
PTZ0005198 thioredoxin; Provisional 90.82
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 90.35
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 90.33
PHA02278103 thioredoxin-like protein 89.87
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 89.63
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 89.3
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 89.2
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 89.19
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 89.05
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 88.9
cd02955124 SSP411 TRX domain, SSP411 protein family; members 88.38
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 88.3
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 86.77
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 85.1
KOG0907106 consensus Thioredoxin [Posttranslational modificat 84.84
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 83.67
PLN02309457 5'-adenylylsulfate reductase 80.9
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 80.66
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 80.34
PTZ00062204 glutaredoxin; Provisional 80.03
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information 
Probab=100.00  E-value=5.3e-66  Score=386.53  Aligned_cols=100  Identities=76%  Similarity=1.336  Sum_probs=93.4

Q ss_pred             HHHhhHHHHHHhHHhhccceEEEEEeCCCcccccccccccCcceEEEEeecceeEEecCCCCCceEEeecCChhhHHHHH
Q 033474           13 LNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIV   92 (118)
Q Consensus        13 ~Cm~mDevL~~~ae~v~nfA~IYlvDi~eVpdfn~myeL~dP~tvMFFfrnkHm~vD~GTgnnnKin~~~~~kQefIDIi   92 (118)
                      +||+|||+|+++|++|||||+||+||++|||+||+||||+||||+||||||||||||+||||||||||+++|||||||||
T Consensus        34 ~Cm~mDeiL~~~a~~v~~~a~IY~vDi~~Vpdfn~~yel~dP~tvmFF~rnkhm~vD~GtgnnnKin~~~~~kqe~iDii  113 (133)
T PF02966_consen   34 VCMQMDEILYKIAEKVKNFAVIYLVDIDEVPDFNQMYELYDPCTVMFFFRNKHMMVDFGTGNNNKINWAFEDKQEFIDII  113 (133)
T ss_dssp             HHHHHHHHHHHHHHHHTTTEEEEEEETTTTHCCHHHTTS-SSEEEEEEETTEEEEEESSSSSSSSBCS--SCHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHhhcceEEEEEEcccchhhhcccccCCCeEEEEEecCeEEEEEecCCCccEEEEEcCcHHHHHHHH
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhccccCceeEEccCCc
Q 033474           93 ETVYRGARKGRGLVIAPKDY  112 (118)
Q Consensus        93 E~iyRgA~kGkglV~SP~dy  112 (118)
                      |+|||||+||||||+||+||
T Consensus       114 e~iyrga~kGk~iv~sP~dy  133 (133)
T PF02966_consen  114 ETIYRGARKGKGIVVSPKDY  133 (133)
T ss_dssp             HHHHHHHHTT-SEEE-SS-G
T ss_pred             HHHHHHhhcCCeeEeCCCCC
Confidence            99999999999999999998

Thioredoxin serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of 2 cysteine thiol groups to a disulphide, accompanied by the transfer of 2 electrons and 2 protons. The net result is the covalent interconversion of a disulphide and a dithiol. Compared to human thioredoxin, human U5 snRNP-specific protein U5-15kDa contains 37 additional residues that may cause structural changes which most likely form putative binding sites for other spliceosomal proteins or RNA. Although U5-15kDa apparently lacks protein disulphide isomerase activity, it is strictly required for pre-mRNA splicing [].; GO: 0007067 mitosis, 0005681 spliceosomal complex; PDB: 1SYX_E 1PQN_A 1QGV_A 2AV4_A 1XBS_A 3GIX_A.
>KOG3414 consensus Component of the U4/U6 Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1qgv_A142 Human Spliceosomal Protein U5-15kd Length = 142 1e-50
2av4_A160 Crystal Structure Of Plasmodium Yoelii Thioredoxin- 3e-47
1pqn_A127 Dominant Negative Human Hdim1 (Hdim1 1-128) Length 1e-42
1xbs_A149 Crystal Structure Of Human Dim2: A Dim1-Like Protei 3e-16
3gix_A149 Crystal Structure Of Human Splicing Factor Dim2 Len 3e-16
>pdb|1QGV|A Chain A, Human Spliceosomal Protein U5-15kd Length = 142 Back     alignment and structure 
Iteration: 1

 Score =  194 bits (493), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 88/104 (84%), Positives = 99/104 (95%)
Query: 15  LEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGN 74
           ++MDEVL S+AE +KNFAVIYLVDI+EVPDFN MYELYDP TVMFFFRNKHIMIDLGTGN
Sbjct: 39  MKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGN 98
Query: 75  NNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 118
           NNKINWA++DKQE +DI+ETVYRGARKGRGLV++PKDYSTKYRY
Sbjct: 99  NNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY 142
>pdb|2AV4|A Chain A, Crystal Structure Of Plasmodium Yoelii Thioredoxin-like Protein 4a (dim1) Length = 160 Back     alignment and structure
>pdb|1PQN|A Chain A, Dominant Negative Human Hdim1 (Hdim1 1-128) Length = 127 Back     alignment and structure
>pdb|1XBS|A Chain A, Crystal Structure Of Human Dim2: A Dim1-Like Protein Length = 149 Back     alignment and structure
>pdb|3GIX|A Chain A, Crystal Structure Of Human Splicing Factor Dim2 Length = 149 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 1e-52
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 3e-49
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 2e-42
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Length = 142 Back     alignment and structure
 Score =  160 bits (407), Expect = 1e-52
 Identities = 88/104 (84%), Positives = 99/104 (95%)

Query: 15  LEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGN 74
           ++MDEVL S+AE +KNFAVIYLVDI+EVPDFN MYELYDP TVMFFFRNKHIMIDLGTGN
Sbjct: 39  MKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGN 98

Query: 75  NNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 118
           NNKINWA++DKQE +DI+ETVYRGARKGRGLV++PKDYSTKYRY
Sbjct: 99  NNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY 142
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Length = 160 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 100.0
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.89
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.87
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 97.27
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 97.09
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 97.04
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 97.02
4euy_A105 Uncharacterized protein; structural genomics, PSI- 97.0
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 96.94
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 96.76
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 96.73
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 96.68
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 96.64
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 96.54
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 96.54
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 96.53
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 96.52
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 96.52
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 96.51
2yzu_A109 Thioredoxin; redox protein, electron transport, st 96.46
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 96.37
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 96.29
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 96.21
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 96.21
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 96.2
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 96.17
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 96.16
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 96.14
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 96.13
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 96.13
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 96.12
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 96.04
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 95.99
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 95.98
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 95.91
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 95.88
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 95.82
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 95.75
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 95.74
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 95.61
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 95.55
2l57_A126 Uncharacterized protein; structural genomics, unkn 95.39
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 95.38
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 95.31
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 95.3
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 95.26
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 95.25
2qsi_A137 Putative hydrogenase expression/formation protein; 95.23
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 95.2
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 95.17
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 95.07
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 95.02
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 94.97
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 94.86
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 94.82
1mek_A120 Protein disulfide isomerase; electron transport, r 94.73
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 94.73
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 94.71
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 94.71
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 94.59
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 94.59
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 94.51
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 94.48
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 94.45
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 94.44
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 94.21
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 94.01
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 93.85
2l5l_A136 Thioredoxin; structural genomics, electron transpo 93.78
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 93.73
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 93.61
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 93.39
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 93.23
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 93.13
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 92.99
1wmj_A130 Thioredoxin H-type; structural genomics, program f 92.73
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 92.67
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 92.29
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 92.14
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 91.7
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 91.48
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 91.4
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 91.01
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 90.87
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 90.69
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 90.51
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 90.18
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 89.4
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 89.82
3f9u_A172 Putative exported cytochrome C biogenesis-related; 89.76
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 89.75
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 86.68
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 85.95
2lrn_A152 Thiol:disulfide interchange protein; structural ge 85.69
2kuc_A130 Putative disulphide-isomerase; structural genomics 85.69
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 85.54
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 85.4
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 85.02
1zma_A118 Bacterocin transport accessory protein; alpha-beta 84.8
2hls_A 243 Protein disulfide oxidoreductase; thioredoxin fold 84.5
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 84.44
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 83.98
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 83.46
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 82.04
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 82.08
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 80.94
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 80.03
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
Probab=100.00  E-value=1.5e-39  Score=246.69  Aligned_cols=106  Identities=78%  Similarity=1.313  Sum_probs=98.7

Q ss_pred             HHHhhHHHHHHhHHhhccceEEEEEeCCCcccccccccccCcceEEEEeecceeEEecCCCCCceEEeecCChhhHHHHH
Q 033474           13 LNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIV   92 (118)
Q Consensus        13 ~Cm~mDevL~~~ae~v~nfA~IYlvDi~eVpdfn~myeL~dP~tvMFFfrnkHm~vD~GTgnnnKin~~~~~kQefIDIi   92 (118)
                      -|++|+.+|.++|++.++.+.||.||++|+|++.++|++.+++|+|||++++|++||+|||||||++|++++||+|+++|
T Consensus        55 PCk~m~PvleelA~e~~~~v~f~kVDVDe~~e~a~~y~V~siPT~~fFk~G~~v~vd~Gtgd~~k~vGa~~~k~~l~~~i  134 (160)
T 2av4_A           55 DCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIV  134 (160)
T ss_dssp             HHHHHHHHHHHHHHHHTTTEEEEEEETTTCCTTTTTTTCCSSEEEEEEETTEEEEEECSSSCCSCBCSCCCCHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHccCCcEEEEEECCCCHHHHHHcCCCCCCEEEEEECCEEEEEecCCCCcCeEEeecCCHHHHHHHH
Confidence            39999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhccccCceeEEccCCcccccCC
Q 033474           93 ETVYRGARKGRGLVIAPKDYSTKYRY  118 (118)
Q Consensus        93 E~iyRgA~kGkglV~SP~dys~~~~~  118 (118)
                      |.+||||+||||||+||+||||+|||
T Consensus       135 e~~~r~a~~g~~~v~~p~~~~~~~~~  160 (160)
T 2av4_A          135 ETIFRGARKGRGLVISPKDYSTKYKY  160 (160)
T ss_dssp             HHHHHHHHTTCSEEECSSCC------
T ss_pred             HHHHHHhhcCCeEEECCCccchhccC
Confidence            99999999999999999999999987
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d1qgva_137 c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human 4e-30
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: spliceosomal protein U5-15Kd
domain: spliceosomal protein U5-15Kd
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  102 bits (256), Expect = 4e-30
 Identities = 84/98 (85%), Positives = 93/98 (94%)

Query: 17  MDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNN 76
           MDEVL S+AE +KNFAVIYLVDI+EVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNN
Sbjct: 40  MDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNN 99

Query: 77  KINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYST 114
           KINWA++DKQE +DI+ETVYRGARKGRGLV++PKDYST
Sbjct: 100 KINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYST 137

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.97
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 97.29
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 97.28
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 97.09
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 97.03
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 97.02
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 96.89
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 96.84
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 96.7
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 96.41
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 96.29
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 96.03
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 96.03
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 96.01
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 95.87
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 95.12
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 94.67
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 94.46
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 92.82
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 92.18
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 91.76
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 91.25
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 90.54
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 89.66
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 89.59
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: spliceosomal protein U5-15Kd
domain: spliceosomal protein U5-15Kd
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=7.9e-32  Score=193.04  Aligned_cols=104  Identities=81%  Similarity=1.286  Sum_probs=94.9

Q ss_pred             HHHHHhhHHHHHHhHHhhccceEEEEEeCCCcccccccccccCcceEEEEeecceeEEecCCCCCceEEeecCChhhHHH
Q 033474           11 LILNLEMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFID   90 (118)
Q Consensus        11 ~~~Cm~mDevL~~~ae~v~nfA~IYlvDi~eVpdfn~myeL~dP~tvMFFfrnkHm~vD~GTgnnnKin~~~~~kQefID   90 (118)
                      +-.|.+|+.+|.++|++.++.+.++.||+++.|++.+.|++...+|++||.+|+||++|.|+|+++|++++++++|||+|
T Consensus        34 C~~C~~~~p~l~~la~~~~~~v~~~~VDvd~~~~la~~~~I~~~PT~~~f~~g~~i~~~~g~~~~~k~~~~l~~~~~~i~  113 (137)
T d1qgva_          34 DPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVD  113 (137)
T ss_dssp             SHHHHHHHHHHHHHHHHHTTTEEEEEEETTTCCTTTTSSCSCSSCEEEEEETTEEEEEECC------CCSCCSCHHHHHH
T ss_pred             CccchhcChHHHHHHHHhhccceEEEeeccccchhhhhcCeeeEEEEEEEeCCcEEEEEecCCCcceeeeehhhhHHHHH
Confidence            45799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhccccCceeEEccCCccc
Q 033474           91 IVETVYRGARKGRGLVIAPKDYST  114 (118)
Q Consensus        91 IiE~iyRgA~kGkglV~SP~dys~  114 (118)
                      +||.+||||++|||+|+||+||||
T Consensus       114 ~ie~i~~~~~~gk~~~~sp~~~~~  137 (137)
T d1qgva_         114 IIETVYRGARKGRGLVVSPKDYST  137 (137)
T ss_dssp             HHHHHHHHHTTTCSEEECCCCCC-
T ss_pred             HHHHHHHHHhhCCceEeCCcccCC
Confidence            999999999999999999999997
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure