Citrus Sinensis ID: 033477


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MSEETKKSVTGALVVKPNSDDRKPTVAVSQSGKRIIIKSADMKEDLQKEAVDIAIAAFEKNSVEKDVAERIKKDFDKKHGPTWHCIVGSNFGSYVTHETNHFVYFYLDQKAVLLFKSG
ccHHHHccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccEEEEEccccEEEEEEccccEEEEEEccEEEEEEEEc
***********************************IIKSADMKEDLQKEAVDIAIAAFEKNSVEKDVAERIKKDFDKKHGPTWHCIVGSNFGSYVTHETNHFVYFYLDQKAVLLFKSG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEETKKSVTGALVVKPNSDDRKPTVAVSQSGKRIIIKSADMKEDLQKEAVDIAIAAFEKNSVEKDVAERIKKDFDKKHGPTWHCIVGSNFGSYVTHETNHFVYFYLDQKAVLLFKSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynein light chain 1, cytoplasmic Acts as a non-catalytic accessory component of a dynein complex.probableQ22799
Dynein light chain, cytoplasmic Acts as a non-catalytic accessory component of a dynein complex.probableQ86A88
Dynein light chain 2, cytoplasmic Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.probableQ96FJ2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YO3, chain A
Confidence level:very confident
Coverage over the Query: 34-118
View the alignment between query and template
View the model in PyMOL