Citrus Sinensis ID: 033485
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| 225441207 | 119 | PREDICTED: zinc finger protein 593-like | 0.991 | 0.983 | 0.820 | 1e-50 | |
| 224068781 | 120 | predicted protein [Populus trichocarpa] | 0.991 | 0.975 | 0.796 | 9e-48 | |
| 224138758 | 122 | predicted protein [Populus trichocarpa] | 0.991 | 0.959 | 0.791 | 1e-47 | |
| 449451052 | 119 | PREDICTED: zinc finger protein 593-like | 0.974 | 0.966 | 0.791 | 1e-47 | |
| 351722567 | 119 | uncharacterized protein LOC100527632 [Gl | 0.974 | 0.966 | 0.791 | 1e-47 | |
| 351726910 | 119 | uncharacterized protein LOC100499707 [Gl | 0.991 | 0.983 | 0.769 | 1e-47 | |
| 388519937 | 119 | unknown [Lotus japonicus] | 0.991 | 0.983 | 0.769 | 4e-47 | |
| 116786054 | 125 | unknown [Picea sitchensis] | 0.966 | 0.912 | 0.763 | 1e-46 | |
| 388492068 | 119 | unknown [Medicago truncatula] | 0.991 | 0.983 | 0.743 | 4e-45 | |
| 297739955 | 120 | unnamed protein product [Vitis vinifera] | 0.991 | 0.975 | 0.745 | 4e-44 |
| >gi|225441207|ref|XP_002270931.1| PREDICTED: zinc finger protein 593-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 203 bits (516), Expect = 1e-50, Method: Compositional matrix adjust.
Identities = 96/117 (82%), Positives = 105/117 (89%)
Query: 2 GKCPNRKVKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYCL 61
GKCP+RKVKKRRYSHKTAR KFL KGDDAVYDEL + + K PLP DEDLPGMGQYYCL
Sbjct: 3 GKCPSRKVKKRRYSHKTARRDKFLLKGDDAVYDELNKPEGEKKPLPVDEDLPGMGQYYCL 62
Query: 62 HCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKLMPV 118
HCDRYFA+ +VRDEHFKTKRHKKR+K+MMGP PHTQLDADLAAGMG+PDNGPKLM +
Sbjct: 63 HCDRYFANVAVRDEHFKTKRHKKRLKQMMGPAPHTQLDADLAAGMGLPDNGPKLMSI 119
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224068781|ref|XP_002326198.1| predicted protein [Populus trichocarpa] gi|118482423|gb|ABK93134.1| unknown [Populus trichocarpa] gi|222833391|gb|EEE71868.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224138758|ref|XP_002322894.1| predicted protein [Populus trichocarpa] gi|222867524|gb|EEF04655.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449451052|ref|XP_004143276.1| PREDICTED: zinc finger protein 593-like [Cucumis sativus] gi|449482412|ref|XP_004156274.1| PREDICTED: zinc finger protein 593-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|351722567|ref|NP_001235201.1| uncharacterized protein LOC100527632 [Glycine max] gi|255632816|gb|ACU16761.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351726910|ref|NP_001238678.1| uncharacterized protein LOC100499707 [Glycine max] gi|255625975|gb|ACU13332.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388519937|gb|AFK48030.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|116786054|gb|ABK23952.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|388492068|gb|AFK34100.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297739955|emb|CBI30137.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| TAIR|locus:2057926 | 198 | AT2G36930 [Arabidopsis thalian | 0.983 | 0.585 | 0.732 | 1.9e-44 | |
| UNIPROTKB|Q5ZIT0 | 133 | ZNF593 "Uncharacterized protei | 0.838 | 0.744 | 0.424 | 3.3e-15 | |
| CGD|CAL0006015 | 176 | orf19.2934 [Candida albicans ( | 0.779 | 0.522 | 0.42 | 1.4e-14 | |
| ZFIN|ZDB-GENE-040426-1789 | 129 | znf593 "zinc finger protein 59 | 0.864 | 0.790 | 0.407 | 1.4e-14 | |
| SGD|S000004064 | 166 | BUD20 "Protein involved in bud | 0.788 | 0.560 | 0.404 | 2.1e-13 | |
| DICTYBASE|DDB_G0275351 | 141 | DDB_G0275351 "C2H2-type zinc f | 0.830 | 0.695 | 0.392 | 2.7e-13 | |
| WB|WBGene00013236 | 128 | Y56A3A.18 [Caenorhabditis eleg | 0.838 | 0.773 | 0.384 | 2.7e-13 | |
| UNIPROTKB|O00488 | 134 | ZNF593 "Zinc finger protein 59 | 0.872 | 0.768 | 0.398 | 3.4e-13 | |
| POMBASE|SPAC19B12.11c | 124 | SPAC19B12.11c "zinc finger pro | 0.847 | 0.806 | 0.367 | 4.4e-13 | |
| GENEDB_PFALCIPARUM|PF14_0612 | 104 | PF14_0612 "hypothetical protei | 0.796 | 0.903 | 0.404 | 6.4e-12 |
| TAIR|locus:2057926 AT2G36930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 468 (169.8 bits), Expect = 1.9e-44, P = 1.9e-44
Identities = 85/116 (73%), Positives = 96/116 (82%)
Query: 1 MGKCPNRKVKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYC 60
MG+CP RKVKKRR SHKTAR KF KGDD VY EL++ ++ PL DEDLPGMGQ+YC
Sbjct: 1 MGRCPTRKVKKRRLSHKTARRDKFEVKGDDLVYTELRKPETEIKPLQLDEDLPGMGQFYC 60
Query: 61 LHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKLM 116
LHCDRYF++ SVRD+HFKTK+HKKRV MMG PH+QLDADLA GMGMPDNGPKLM
Sbjct: 61 LHCDRYFSNVSVRDDHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLM 116
|
|
| UNIPROTKB|Q5ZIT0 ZNF593 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006015 orf19.2934 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1789 znf593 "zinc finger protein 593" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004064 BUD20 "Protein involved in bud-site selection" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0275351 DDB_G0275351 "C2H2-type zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00013236 Y56A3A.18 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00488 ZNF593 "Zinc finger protein 593" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC19B12.11c SPAC19B12.11c "zinc finger protein, human ZNF593 ortholog" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF14_0612 PF14_0612 "hypothetical protein" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_kg.C_280011 | SubName- Full=Putative uncharacterized protein; (121 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| estExt_fgenesh4_pm.C_1070023 | • | • | 0.529 | ||||||||
| estExt_Genewise1_v1.C_LG_IV0024 | • | • | • | 0.510 | |||||||
| grail3.0106016302 | • | • | 0.476 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 118 | |||
| COG5112 | 126 | COG5112, UFD2, U1-like Zn-finger-containing protei | 8e-20 | |
| pfam12171 | 27 | pfam12171, zf-C2H2_jaz, Zinc-finger double-strande | 2e-08 | |
| smart00451 | 35 | smart00451, ZnF_U1, U1-like zinc finger | 2e-06 |
| >gnl|CDD|227443 COG5112, UFD2, U1-like Zn-finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
Score = 77.8 bits (191), Expect = 8e-20
Identities = 42/106 (39%), Positives = 62/106 (58%), Gaps = 3/106 (2%)
Query: 1 MGKCPNRKVKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYC 60
MG+ + K KKRR + + + + D + ++L +S K LP+D +LPG+GQ+YC
Sbjct: 1 MGRS-DTKRKKRRSNRLRIKRTRLFGRDLDQIKNDLSTKESQKK-LPYDPELPGLGQHYC 58
Query: 61 LHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGM 106
+ C RYF E EH K K HK+R KE+ P+TQ DA+ A G+
Sbjct: 59 IECARYFITEKALMEHKKGKVHKRRAKELRE-VPYTQEDAEAAVGL 103
|
Length = 126 |
| >gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding | Back alignment and domain information |
|---|
| >gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| KOG3408 | 129 | consensus U1-like Zn-finger-containing protein, pr | 100.0 | |
| COG5112 | 126 | UFD2 U1-like Zn-finger-containing protein [General | 100.0 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 99.11 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 99.04 | |
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 98.56 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 98.46 | |
| KOG3454 | 165 | consensus U1 snRNP-specific protein C [RNA process | 98.32 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.19 | |
| KOG4727 | 193 | consensus U1-like Zn-finger protein [General funct | 97.57 | |
| COG5188 | 470 | PRP9 Splicing factor 3a, subunit 3 [RNA processing | 97.31 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 97.11 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 96.68 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 96.51 | |
| COG5136 | 188 | U1 snRNP-specific protein C [RNA processing and mo | 96.43 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 96.42 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 96.4 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 96.15 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 95.9 | |
| KOG0150 | 336 | consensus Spliceosomal protein FBP21 [RNA processi | 94.84 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 93.57 | |
| PHA00616 | 44 | hypothetical protein | 93.3 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 93.09 | |
| KOG2785 | 390 | consensus C2H2-type Zn-finger protein [General fun | 93.04 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 92.98 | |
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 92.09 | |
| KOG1994 | 268 | consensus Predicted RNA binding protein, contains | 91.77 | |
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 90.53 | |
| KOG2837 | 309 | consensus Protein containing a U1-type Zn-finger a | 90.04 | |
| KOG3032 | 264 | consensus Uncharacterized conserved protein [Funct | 89.04 | |
| PTZ00448 | 373 | hypothetical protein; Provisional | 88.74 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 88.35 | |
| PF13821 | 55 | DUF4187: Domain of unknown function (DUF4187) | 87.97 | |
| KOG2482 | 423 | consensus Predicted C2H2-type Zn-finger protein [T | 87.74 | |
| PHA00732 | 79 | hypothetical protein | 86.54 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 85.9 | |
| KOG2893 | 341 | consensus Zn finger protein [General function pred | 81.73 | |
| PHA00733 | 128 | hypothetical protein | 81.02 | |
| PHA00733 | 128 | hypothetical protein | 80.18 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 80.07 |
| >KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-39 Score=238.47 Aligned_cols=105 Identities=35% Similarity=0.590 Sum_probs=90.8
Q ss_pred cchhhhhhhhhcccCC-CchHHHHhhccCcCCCCCCCCCCCCCCCCcccccccccccCChHHHHHHhcchhhHHHHHHhh
Q 033485 12 RRYSHKTARLAKFLRK-GDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMM 90 (118)
Q Consensus 12 ~~~~~kt~rrt~~~~k-D~DqI~~dl~~~~~~~~~~~~dedlpg~GqfYC~~Cdr~F~~~~~l~~H~ksK~HKrrvK~l~ 90 (118)
++.......|++-+++ |||||++||........++++|+||||+|||||++|+|||+++++|+.|++||.||||||+|+
T Consensus 11 ~~~~~hr~~r~r~~~r~dLDqi~~dl~~~~~kll~~~~D~dlPG~GqfyCi~CaRyFi~~~~l~~H~ktK~HKrRvK~l~ 90 (129)
T KOG3408|consen 11 HRSNRHRINRTRGRARKDLDQIDEDLETQKGKLLNQEIDPDLPGGGQFYCIECARYFIDAKALKTHFKTKVHKRRVKELR 90 (129)
T ss_pred ccchhHHHHhhhccCcccccccccccccccchhhcCcCCCCCCCCceeehhhhhhhhcchHHHHHHHhccHHHHHHHhcc
Confidence 3333344456666555 999999999765544568999999999999999999999999999999999999999999999
Q ss_pred CCCCCCHHHHHHhcCCC-CCCCCCCCCC
Q 033485 91 GPKPHTQLDADLAAGMG-MPDNGPKLMP 117 (118)
Q Consensus 91 ~~~pytq~eAe~aag~g-~~dng~~l~~ 117 (118)
++||||+|||+|+||| +|++++++++
T Consensus 91 -~~PySQeeAe~A~G~g~vpp~~~~~~s 117 (129)
T KOG3408|consen 91 -EVPYSQEEAEAAAGMGFVPPKKLKVES 117 (129)
T ss_pred -cCCccHHHHHHhccCCcCCCcchhhhh
Confidence 6799999999999999 8899988765
|
|
| >COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >KOG3454 consensus U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4727 consensus U1-like Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >COG5136 U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1994 consensus Predicted RNA binding protein, contains G-patch and Zn-finger domains [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >KOG2837 consensus Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3032 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00448 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF13821 DUF4187: Domain of unknown function (DUF4187) | Back alignment and domain information |
|---|
| >KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >KOG2893 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 118 | ||||
| 1zr9_A | 124 | Solution Structure Of A Human C2h2-Type Zinc Finger | 5e-11 |
| >pdb|1ZR9|A Chain A, Solution Structure Of A Human C2h2-Type Zinc Finger Protein Length = 124 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 118 | |||
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 1e-26 | |
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 2e-04 |
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Length = 124 | Back alignment and structure |
|---|
Score = 94.8 bits (235), Expect = 1e-26
Identities = 39/114 (34%), Positives = 58/114 (50%), Gaps = 10/114 (8%)
Query: 9 VKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAK----NPLPFDEDLPGMGQYYCLHCD 64
+ K R L D ++ EL+ SA+ FD DLPG G + CL C
Sbjct: 2 HHHHHHLEKAKRRRPDL----DEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACA 57
Query: 65 RYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKLMPV 118
RYF + HF++K HKKR+K+ + +P++Q +A+ AAGMG P+ + V
Sbjct: 58 RYFIDSTNLKTHFRSKDHKKRLKQ-LSVEPYSQEEAERAAGMGS-YVPPRRLAV 109
|
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Length = 77 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 99.97 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 98.67 | |
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 98.48 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 97.73 | |
| 4dgw_A | 402 | PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A | 97.69 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 97.01 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.9 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 96.89 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.87 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 96.87 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 96.82 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.79 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.79 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 96.76 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.76 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.76 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 96.69 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 96.69 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 96.67 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 96.67 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.66 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 96.62 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 96.62 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 96.61 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.6 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.59 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.59 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.59 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 96.59 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 96.57 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 96.57 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.56 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.56 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.55 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.53 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.53 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.52 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 96.52 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 96.52 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.52 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.51 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.51 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 95.52 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 96.5 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.5 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.5 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.49 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.49 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 96.48 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.48 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.48 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.48 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 96.48 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.47 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.47 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.47 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.46 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 96.44 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 96.44 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.44 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.44 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 96.44 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.43 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.43 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.43 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.42 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.42 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.42 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.4 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.4 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.4 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 96.39 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.38 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.38 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.37 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.37 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 96.37 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.37 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.37 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.37 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.36 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.36 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.36 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 96.36 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.35 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.35 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.35 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.35 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.35 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.35 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.35 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.35 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.35 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 96.34 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.33 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.33 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.33 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 96.33 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.32 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.32 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.31 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.31 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.31 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.29 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.28 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.28 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 96.28 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.27 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.26 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.26 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 96.24 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.24 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 96.23 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.22 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.21 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 96.21 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 95.2 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.19 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.19 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.18 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.17 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 96.16 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.16 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.15 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 96.15 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 96.14 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.14 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.14 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.14 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 96.12 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.11 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 96.1 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.09 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.09 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 96.09 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 96.05 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 96.04 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 96.03 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 96.02 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.99 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 95.96 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 95.95 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 95.72 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 95.71 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 95.71 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 95.63 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 95.54 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 95.53 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 95.52 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 95.49 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 95.47 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 95.45 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 95.43 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 95.33 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 95.25 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 95.21 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 95.17 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 95.14 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 95.11 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 95.08 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 95.07 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 95.05 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 95.04 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 95.0 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 94.97 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 94.96 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 94.92 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 94.87 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 94.86 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 94.84 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 94.75 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 94.73 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 94.67 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 94.62 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 94.42 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 94.4 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 94.39 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 94.37 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 94.32 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 94.31 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 94.29 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 94.24 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 94.23 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 94.17 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 94.07 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 94.06 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 93.96 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 93.93 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 93.9 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 93.87 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 93.85 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 93.75 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 93.73 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 93.7 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 93.69 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 93.67 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 93.62 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 93.46 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 93.46 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 93.45 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 93.44 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 93.42 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 93.37 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 93.36 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 93.36 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 93.32 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 93.23 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 93.21 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 93.12 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 93.01 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 92.8 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 92.75 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 92.74 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 92.67 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 92.63 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 92.49 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 92.3 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 92.22 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 92.21 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 92.16 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 92.13 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 91.93 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 91.89 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 91.7 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 90.92 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 90.86 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 90.74 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 90.51 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 90.11 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 90.06 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 88.75 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 88.13 | |
| 4f9c_B | 144 | Protein DBF4 homolog A; Ser/Thr protein kinase, tr | 87.27 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 87.19 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 87.07 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 86.88 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 85.38 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 84.91 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 83.49 |
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
Probab=99.97 E-value=1.2e-31 Score=195.72 Aligned_cols=90 Identities=40% Similarity=0.613 Sum_probs=62.3
Q ss_pred hhhhhhcccCCCchHHHHhhccCcCCC-C---CCCCCCCCCCCCcccccccccccCChHHHHHHhcchhhHHHHHHhhCC
Q 033485 17 KTARLAKFLRKGDDAVYDELQRSDSAK-N---PLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGP 92 (118)
Q Consensus 17 kt~rrt~~~~kD~DqI~~dl~~~~~~~-~---~~~~dedlpg~GqfYC~~Cdr~F~~~~~l~~H~ksK~HKrrvK~l~~~ 92 (118)
||+||++ |+|||++||.++.... . ++++|+|+||.++|||++|+|+|.+.++|.+|++||.|++||+.|. +
T Consensus 10 ~tkrr~r----DlDqI~~dl~~e~~~k~~~~~~~~~ded~tGekpfyC~~C~K~F~~~~~L~~H~rsK~HKrrvk~l~-~ 84 (124)
T 1zr9_A 10 KAKRRRP----DLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLS-V 84 (124)
T ss_dssp ------------------------------CCSCSSCSSSGGGGCSEETTTTEECSSHHHHHHHTTCHHHHHHHHHHT-S
T ss_pred hhcccCC----CHHHHHHHHHhHHHHHhhccccccccccCCCCcceEcccCcchhCCHHHHHHHHhhhhhhHHHHHhc-c
Confidence 6677776 9999999997655332 3 7899999999999999999999999999999999999999999998 6
Q ss_pred CCCCHHHHHHhcCCCCCCC
Q 033485 93 KPHTQLDADLAAGMGMPDN 111 (118)
Q Consensus 93 ~pytq~eAe~aag~g~~dn 111 (118)
.||||+|||+|||||++..
T Consensus 85 ~p~Tq~eAe~aag~g~~~~ 103 (124)
T 1zr9_A 85 EPYSQEEAERAAGMGSYVP 103 (124)
T ss_dssp CSSCTTTSSCSCCCCCCC-
T ss_pred CCCcHHHHHHhccCCCCCC
Confidence 7999999999999998443
|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 118 | ||||
| d1zr9a1 | 67 | g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 | 8e-28 | |
| d2vrda1 | 61 | g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human | 7e-05 |
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: Zinc finger protein 593, ZNF593 species: Human (Homo sapiens) [TaxId: 9606]
Score = 94.8 bits (236), Expect = 8e-28
Identities = 29/61 (47%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
Query: 47 PFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGM 106
FD DLPG G + CL C RYF + HF++K HKKR+K+ + +P++Q +A+ AAGM
Sbjct: 5 EFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQ-LSVEPYSQEEAERAAGM 63
Query: 107 G 107
G
Sbjct: 64 G 64
|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 99.97 | |
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 98.72 | |
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 97.94 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 97.22 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.96 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 96.89 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 96.86 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 96.81 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 96.79 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.77 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 96.77 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 96.75 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.66 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 96.37 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 96.21 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.17 | |
| d1zu1a1 | 72 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 96.16 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 96.13 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 96.13 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 95.99 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 95.94 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 95.84 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 95.74 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 95.47 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 95.39 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 95.3 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 95.0 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 94.68 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 94.39 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 94.29 | |
| d1fu9a_ | 36 | U-shaped transcription factor, different fingers { | 93.92 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 93.79 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 93.6 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 92.87 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 92.84 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 92.74 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 92.1 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 91.45 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 90.0 | |
| d1m36a_ | 33 | Monocytic leukemia zinc finger protein Moz {Human | 87.85 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 85.81 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 85.22 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 82.29 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 82.21 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 81.35 |
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: Zinc finger protein 593, ZNF593 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97 E-value=5.6e-32 Score=178.07 Aligned_cols=64 Identities=45% Similarity=0.775 Sum_probs=61.3
Q ss_pred CCCCCCCCCCCCCcccccccccccCChHHHHHHhcchhhHHHHHHhhCCCCCCHHHHHHhcCCCC
Q 033485 44 NPLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGM 108 (118)
Q Consensus 44 ~~~~~dedlpg~GqfYC~~Cdr~F~~~~~l~~H~ksK~HKrrvK~l~~~~pytq~eAe~aag~g~ 108 (118)
.++++|+|+||+|||||++|+|||+|+++|++|++||+|||||++|+ ++||||+|||+|||||+
T Consensus 2 ~~~e~D~D~pG~gqfYCv~C~K~F~se~~l~~H~ksKkHKrrvk~L~-~~p~t~~eae~AaG~Gs 65 (67)
T d1zr9a1 2 PNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLS-VEPYSQEEAERAAGMGS 65 (67)
T ss_dssp CSCSSCSSSGGGGCSEETTTTEECSSHHHHHHHTTCHHHHHHHHHHT-SCSSCTTTSSCSCCCCC
T ss_pred CCCCCCCCCCCCCEEecccccCccCCHHHHHHHHcccHHHHHHHHhc-cCcCCHHHHHHhcCCcC
Confidence 36899999999999999999999999999999999999999999998 57999999999999996
|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|