Citrus Sinensis ID: 033485


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MGKCPNRKVKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKLMPV
ccccccccccccccHHHHHHHHHccccccHHHHHHHcccccccccccccccccccccccEEccccccccHHHHHHHHcHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccc
ccccccccccccccccccccccccccccHHHHHHHHccHHHHHccccccccccccccEEEEcHHHHHccHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHccccccccccEccc
mgkcpnrkvkkrrySHKTARLAKFLRKGDDAVYdelqrsdsaknplpfdedlpgmgqyyclhcdryfahesvrdehfkTKRHKKRVkemmgpkphtqldadlaagmgmpdngpklmpv
mgkcpnrkvkkrryshktarlakflrkgddAVYDelqrsdsaknplpFDEDLPGMGQYYCLHCDRYFAHesvrdehfktkrhkkrvkemmgpkphTQLDADLAAGMGMPDNGPKLMPV
MGKCPNRKVKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKLMPV
***************************************************LPGMGQYYCLHCDRYFAHESV**********************************************
********************LAKFLRKGDDAVYD*****************LPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPD********
****************KTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYCLHCDRYFAHESVRD****************GPKPHTQLDADLAAGMGMPDNGPKLMPV
***********************FLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKL***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKCPNRKVKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKLMPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
Q08004166 Bud site selection protei yes no 0.771 0.548 0.405 5e-12
B0BLT0128 Zinc finger protein 593 O yes no 0.567 0.523 0.506 5e-12
Q9U239128 Zinc finger protein 593 h yes no 0.661 0.609 0.425 2e-10
Q553S1141 Zinc finger protein 593 h yes no 0.838 0.702 0.388 3e-10
Q9P370124 Zinc finger protein bud20 yes no 0.661 0.629 0.4 3e-10
O00488134 Zinc finger protein 593 O yes no 0.779 0.686 0.424 4e-10
Q8SWF6104 Zinc finger C2H2 protein yes no 0.788 0.894 0.36 1e-08
Q9DB42134 Zinc finger protein 593 O yes no 0.491 0.432 0.474 4e-08
Q9W3Y0162 Zinc finger protein 593 h yes no 0.5 0.364 0.416 4e-08
>sp|Q08004|BUD20_YEAST Bud site selection protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD20 PE=1 SV=1 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 57/101 (56%), Gaps = 10/101 (9%)

Query: 13  RYS---HKTARLAKFLRKGDDAVYDELQRSDSAKNPL--PFDEDLPGMGQYYCLHCDRYF 67
           RYS   +KT R  + L    D +Y++L   +S +  L  P DE  PG+GQ+YC+HC +Y 
Sbjct: 3   RYSVKRYKTKRRTRDL----DLIYNDLSTKESVQKLLNQPLDETKPGLGQHYCIHCAKYM 58

Query: 68  AHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGM 108
                   H K K HK+RVKE+ G  P+TQ  +D AAG  +
Sbjct: 59  ETAIALKTHLKGKVHKRRVKELRGV-PYTQEVSDAAAGYNL 98




Involved in positioning the proximal bud pole signal.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
>sp|B0BLT0|ZN593_XENTR Zinc finger protein 593 OS=Xenopus tropicalis GN=znf593 PE=2 SV=1 Back     alignment and function description
>sp|Q9U239|ZN593_CAEEL Zinc finger protein 593 homolog OS=Caenorhabditis elegans GN=Y56A3A.18 PE=3 SV=1 Back     alignment and function description
>sp|Q553S1|ZN593_DICDI Zinc finger protein 593 homolog OS=Dictyostelium discoideum GN=DDB_G0275351 PE=3 SV=1 Back     alignment and function description
>sp|Q9P370|BUD20_SCHPO Zinc finger protein bud20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bud20 PE=3 SV=1 Back     alignment and function description
>sp|O00488|ZN593_HUMAN Zinc finger protein 593 OS=Homo sapiens GN=ZNF593 PE=1 SV=2 Back     alignment and function description
>sp|Q8SWF6|Z231_ENCCU Zinc finger C2H2 protein ECU02_0310 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0310 PE=3 SV=1 Back     alignment and function description
>sp|Q9DB42|ZN593_MOUSE Zinc finger protein 593 OS=Mus musculus GN=Znf593 PE=2 SV=2 Back     alignment and function description
>sp|Q9W3Y0|ZN593_DROME Zinc finger protein 593 homolog OS=Drosophila melanogaster GN=CG3224 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
225441207119 PREDICTED: zinc finger protein 593-like 0.991 0.983 0.820 1e-50
224068781120 predicted protein [Populus trichocarpa] 0.991 0.975 0.796 9e-48
224138758122 predicted protein [Populus trichocarpa] 0.991 0.959 0.791 1e-47
449451052119 PREDICTED: zinc finger protein 593-like 0.974 0.966 0.791 1e-47
351722567119 uncharacterized protein LOC100527632 [Gl 0.974 0.966 0.791 1e-47
351726910119 uncharacterized protein LOC100499707 [Gl 0.991 0.983 0.769 1e-47
388519937119 unknown [Lotus japonicus] 0.991 0.983 0.769 4e-47
116786054125 unknown [Picea sitchensis] 0.966 0.912 0.763 1e-46
388492068119 unknown [Medicago truncatula] 0.991 0.983 0.743 4e-45
297739955120 unnamed protein product [Vitis vinifera] 0.991 0.975 0.745 4e-44
>gi|225441207|ref|XP_002270931.1| PREDICTED: zinc finger protein 593-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (89%)

Query: 2   GKCPNRKVKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYCL 61
           GKCP+RKVKKRRYSHKTAR  KFL KGDDAVYDEL + +  K PLP DEDLPGMGQYYCL
Sbjct: 3   GKCPSRKVKKRRYSHKTARRDKFLLKGDDAVYDELNKPEGEKKPLPVDEDLPGMGQYYCL 62

Query: 62  HCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKLMPV 118
           HCDRYFA+ +VRDEHFKTKRHKKR+K+MMGP PHTQLDADLAAGMG+PDNGPKLM +
Sbjct: 63  HCDRYFANVAVRDEHFKTKRHKKRLKQMMGPAPHTQLDADLAAGMGLPDNGPKLMSI 119




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224068781|ref|XP_002326198.1| predicted protein [Populus trichocarpa] gi|118482423|gb|ABK93134.1| unknown [Populus trichocarpa] gi|222833391|gb|EEE71868.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224138758|ref|XP_002322894.1| predicted protein [Populus trichocarpa] gi|222867524|gb|EEF04655.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449451052|ref|XP_004143276.1| PREDICTED: zinc finger protein 593-like [Cucumis sativus] gi|449482412|ref|XP_004156274.1| PREDICTED: zinc finger protein 593-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351722567|ref|NP_001235201.1| uncharacterized protein LOC100527632 [Glycine max] gi|255632816|gb|ACU16761.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351726910|ref|NP_001238678.1| uncharacterized protein LOC100499707 [Glycine max] gi|255625975|gb|ACU13332.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388519937|gb|AFK48030.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|116786054|gb|ABK23952.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|388492068|gb|AFK34100.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297739955|emb|CBI30137.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
TAIR|locus:2057926198 AT2G36930 [Arabidopsis thalian 0.983 0.585 0.732 1.9e-44
UNIPROTKB|Q5ZIT0133 ZNF593 "Uncharacterized protei 0.838 0.744 0.424 3.3e-15
CGD|CAL0006015176 orf19.2934 [Candida albicans ( 0.779 0.522 0.42 1.4e-14
ZFIN|ZDB-GENE-040426-1789129 znf593 "zinc finger protein 59 0.864 0.790 0.407 1.4e-14
SGD|S000004064166 BUD20 "Protein involved in bud 0.788 0.560 0.404 2.1e-13
DICTYBASE|DDB_G0275351141 DDB_G0275351 "C2H2-type zinc f 0.830 0.695 0.392 2.7e-13
WB|WBGene00013236128 Y56A3A.18 [Caenorhabditis eleg 0.838 0.773 0.384 2.7e-13
UNIPROTKB|O00488134 ZNF593 "Zinc finger protein 59 0.872 0.768 0.398 3.4e-13
POMBASE|SPAC19B12.11c124 SPAC19B12.11c "zinc finger pro 0.847 0.806 0.367 4.4e-13
GENEDB_PFALCIPARUM|PF14_0612104 PF14_0612 "hypothetical protei 0.796 0.903 0.404 6.4e-12
TAIR|locus:2057926 AT2G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 468 (169.8 bits), Expect = 1.9e-44, P = 1.9e-44
 Identities = 85/116 (73%), Positives = 96/116 (82%)

Query:     1 MGKCPNRKVKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYC 60
             MG+CP RKVKKRR SHKTAR  KF  KGDD VY EL++ ++   PL  DEDLPGMGQ+YC
Sbjct:     1 MGRCPTRKVKKRRLSHKTARRDKFEVKGDDLVYTELRKPETEIKPLQLDEDLPGMGQFYC 60

Query:    61 LHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKLM 116
             LHCDRYF++ SVRD+HFKTK+HKKRV  MMG  PH+QLDADLA GMGMPDNGPKLM
Sbjct:    61 LHCDRYFSNVSVRDDHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLM 116


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0051604 "protein maturation" evidence=RCA
UNIPROTKB|Q5ZIT0 ZNF593 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
CGD|CAL0006015 orf19.2934 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1789 znf593 "zinc finger protein 593" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000004064 BUD20 "Protein involved in bud-site selection" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0275351 DDB_G0275351 "C2H2-type zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00013236 Y56A3A.18 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O00488 ZNF593 "Zinc finger protein 593" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPAC19B12.11c SPAC19B12.11c "zinc finger protein, human ZNF593 ortholog" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0612 PF14_0612 "hypothetical protein" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_kg.C_280011
SubName- Full=Putative uncharacterized protein; (121 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pm.C_1070023
hypothetical protein (554 aa)
      0.529
estExt_Genewise1_v1.C_LG_IV0024
SubName- Full=Putative uncharacterized protein; (604 aa)
     0.510
grail3.0106016302
hypothetical protein (217 aa)
      0.476

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
COG5112126 COG5112, UFD2, U1-like Zn-finger-containing protei 8e-20
pfam1217127 pfam12171, zf-C2H2_jaz, Zinc-finger double-strande 2e-08
smart0045135 smart00451, ZnF_U1, U1-like zinc finger 2e-06
>gnl|CDD|227443 COG5112, UFD2, U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information
 Score = 77.8 bits (191), Expect = 8e-20
 Identities = 42/106 (39%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 1   MGKCPNRKVKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYC 60
           MG+  + K KKRR +    +  +   +  D + ++L   +S K  LP+D +LPG+GQ+YC
Sbjct: 1   MGRS-DTKRKKRRSNRLRIKRTRLFGRDLDQIKNDLSTKESQKK-LPYDPELPGLGQHYC 58

Query: 61  LHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGM 106
           + C RYF  E    EH K K HK+R KE+    P+TQ DA+ A G+
Sbjct: 59  IECARYFITEKALMEHKKGKVHKRRAKELRE-VPYTQEDAEAAVGL 103


Length = 126

>gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding Back     alignment and domain information
>gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
KOG3408129 consensus U1-like Zn-finger-containing protein, pr 100.0
COG5112126 UFD2 U1-like Zn-finger-containing protein [General 100.0
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 99.11
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 99.04
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 98.56
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 98.46
KOG3454165 consensus U1 snRNP-specific protein C [RNA process 98.32
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 98.19
KOG4727193 consensus U1-like Zn-finger protein [General funct 97.57
COG5188 470 PRP9 Splicing factor 3a, subunit 3 [RNA processing 97.31
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.11
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.68
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.51
COG5136 188 U1 snRNP-specific protein C [RNA processing and mo 96.43
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.42
PLN02748468 tRNA dimethylallyltransferase 96.4
PHA0276855 hypothetical protein; Provisional 96.15
smart0035526 ZnF_C2H2 zinc finger. 95.9
KOG0150 336 consensus Spliceosomal protein FBP21 [RNA processi 94.84
KOG2384223 consensus Major histocompatibility complex protein 93.57
PHA0061644 hypothetical protein 93.3
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 93.09
KOG2785 390 consensus C2H2-type Zn-finger protein [General fun 93.04
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.98
PF0753549 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc 92.09
KOG1994268 consensus Predicted RNA binding protein, contains 91.77
smart0058649 ZnF_DBF Zinc finger in DBF-like proteins. 90.53
KOG2837 309 consensus Protein containing a U1-type Zn-finger a 90.04
KOG3032 264 consensus Uncharacterized conserved protein [Funct 89.04
PTZ00448373 hypothetical protein; Provisional 88.74
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 88.35
PF1382155 DUF4187: Domain of unknown function (DUF4187) 87.97
KOG2482 423 consensus Predicted C2H2-type Zn-finger protein [T 87.74
PHA0073279 hypothetical protein 86.54
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 85.9
KOG2893 341 consensus Zn finger protein [General function pred 81.73
PHA00733128 hypothetical protein 81.02
PHA00733128 hypothetical protein 80.18
KOG1074958 consensus Transcriptional repressor SALM [Transcri 80.07
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=1.8e-39  Score=238.47  Aligned_cols=105  Identities=35%  Similarity=0.590  Sum_probs=90.8

Q ss_pred             cchhhhhhhhhcccCC-CchHHHHhhccCcCCCCCCCCCCCCCCCCcccccccccccCChHHHHHHhcchhhHHHHHHhh
Q 033485           12 RRYSHKTARLAKFLRK-GDDAVYDELQRSDSAKNPLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMM   90 (118)
Q Consensus        12 ~~~~~kt~rrt~~~~k-D~DqI~~dl~~~~~~~~~~~~dedlpg~GqfYC~~Cdr~F~~~~~l~~H~ksK~HKrrvK~l~   90 (118)
                      ++.......|++-+++ |||||++||........++++|+||||+|||||++|+|||+++++|+.|++||.||||||+|+
T Consensus        11 ~~~~~hr~~r~r~~~r~dLDqi~~dl~~~~~kll~~~~D~dlPG~GqfyCi~CaRyFi~~~~l~~H~ktK~HKrRvK~l~   90 (129)
T KOG3408|consen   11 HRSNRHRINRTRGRARKDLDQIDEDLETQKGKLLNQEIDPDLPGGGQFYCIECARYFIDAKALKTHFKTKVHKRRVKELR   90 (129)
T ss_pred             ccchhHHHHhhhccCcccccccccccccccchhhcCcCCCCCCCCceeehhhhhhhhcchHHHHHHHhccHHHHHHHhcc
Confidence            3333344456666555 999999999765544568999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCHHHHHHhcCCC-CCCCCCCCCC
Q 033485           91 GPKPHTQLDADLAAGMG-MPDNGPKLMP  117 (118)
Q Consensus        91 ~~~pytq~eAe~aag~g-~~dng~~l~~  117 (118)
                       ++||||+|||+|+||| +|++++++++
T Consensus        91 -~~PySQeeAe~A~G~g~vpp~~~~~~s  117 (129)
T KOG3408|consen   91 -EVPYSQEEAEAAAGMGFVPPKKLKVES  117 (129)
T ss_pred             -cCCccHHHHHHhccCCcCCCcchhhhh
Confidence             6799999999999999 8899988765



>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG3454 consensus U1 snRNP-specific protein C [RNA processing and modification] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4727 consensus U1-like Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5136 U1 snRNP-specific protein C [RNA processing and modification] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1994 consensus Predicted RNA binding protein, contains G-patch and Zn-finger domains [RNA processing and modification] Back     alignment and domain information
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins Back     alignment and domain information
>KOG2837 consensus Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing [RNA processing and modification] Back     alignment and domain information
>KOG3032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00448 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13821 DUF4187: Domain of unknown function (DUF4187) Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1zr9_A124 Solution Structure Of A Human C2h2-Type Zinc Finger 5e-11
>pdb|1ZR9|A Chain A, Solution Structure Of A Human C2h2-Type Zinc Finger Protein Length = 124 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 5/90 (5%) Query: 22 AKFLRKGDDAVYDELQRSDSAK-NPLP---FDEDLPGMGQYYCLHCDRYFAHESVRDEHF 77 AK R D ++ EL+ SA+ P P FD DLPG G + CL C RYF + HF Sbjct: 11 AKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHF 70 Query: 78 KTKRHKKRVKEMMGPKPHTQLDADLAAGMG 107 ++K HKKR+K+ + +P++Q +A+ AAGMG Sbjct: 71 RSKDHKKRLKQ-LSVEPYSQEEAERAAGMG 99

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 1e-26
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 2e-04
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Length = 124 Back     alignment and structure
 Score = 94.8 bits (235), Expect = 1e-26
 Identities = 39/114 (34%), Positives = 58/114 (50%), Gaps = 10/114 (8%)

Query: 9   VKKRRYSHKTARLAKFLRKGDDAVYDELQRSDSAK----NPLPFDEDLPGMGQYYCLHCD 64
                +  K  R    L    D ++ EL+   SA+        FD DLPG G + CL C 
Sbjct: 2   HHHHHHLEKAKRRRPDL----DEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACA 57

Query: 65  RYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGMPDNGPKLMPV 118
           RYF   +    HF++K HKKR+K+ +  +P++Q +A+ AAGMG     P+ + V
Sbjct: 58  RYFIDSTNLKTHFRSKDHKKRLKQ-LSVEPYSQEEAERAAGMGS-YVPPRRLAV 109


>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Length = 77 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 99.97
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 98.67
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 98.48
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.73
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 97.69
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 97.01
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.9
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 96.89
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.87
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 96.87
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 96.82
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.79
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.79
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 96.76
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.76
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.76
1ard_A29 Yeast transcription factor ADR1; transcription reg 96.69
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 96.69
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 96.67
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 96.67
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 96.66
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 96.62
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 96.62
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 96.61
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.6
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.59
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.59
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.59
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 96.59
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 96.57
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 96.57
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.56
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 96.56
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 96.55
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.53
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.53
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.52
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 96.52
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 96.52
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.52
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.51
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 96.51
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.52
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 96.5
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.5
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.5
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.49
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.49
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 96.48
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.48
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.48
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.48
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 96.48
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.47
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.47
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.47
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.46
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 96.44
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 96.44
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.44
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.44
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 96.44
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 96.43
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.43
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.43
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.42
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.42
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.42
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.4
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.4
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.4
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 96.39
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.38
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.38
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.37
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.37
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 96.37
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.37
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.37
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.37
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.36
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.36
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 96.36
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 96.36
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.35
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.35
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.35
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.35
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.35
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.35
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.35
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 96.35
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 95.35
1paa_A30 Yeast transcription factor ADR1; transcription reg 96.34
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.33
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.33
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.33
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 96.33
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.32
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.32
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.31
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.31
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.31
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.29
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.28
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.28
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 96.28
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.27
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.26
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.26
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 96.24
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.24
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 96.23
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.22
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.21
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 96.21
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 95.2
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.19
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.19
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.18
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.17
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.16
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.16
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.15
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 96.15
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 96.14
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.14
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 96.12
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 96.1
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 96.09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.09
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 96.09
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 96.05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 96.04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 96.03
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 96.02
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.99
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 95.96
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 95.95
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 95.72
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 95.71
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 95.71
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 95.63
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 95.54
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 95.53
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 95.52
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 95.49
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 95.47
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 95.45
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 95.43
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 95.33
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 95.25
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 95.21
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 95.17
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 95.14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 95.11
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 95.08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 95.07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 95.05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 95.04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 95.0
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 94.97
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 94.96
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 94.92
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 94.87
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 94.86
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 94.84
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 94.75
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 94.73
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 94.67
2lv2_A85 Insulinoma-associated protein 1; structural genomi 94.62
2lv2_A85 Insulinoma-associated protein 1; structural genomi 94.42
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 94.4
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 94.39
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 94.37
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 94.32
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 94.31
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 94.29
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 94.24
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 94.23
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 94.17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 94.07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 94.06
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 93.96
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 93.93
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 93.9
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 93.87
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 93.85
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 93.75
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 93.73
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 93.7
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 93.69
2epa_A72 Krueppel-like factor 10; transforming growth facto 93.67
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 93.62
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 93.46
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 93.46
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 93.45
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 93.44
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 93.42
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 93.37
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 93.36
2epa_A72 Krueppel-like factor 10; transforming growth facto 93.36
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 93.32
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 93.23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 93.21
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 93.12
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 93.01
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 92.8
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 92.75
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 92.74
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 92.67
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 92.63
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 92.49
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 92.3
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 92.22
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 92.21
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 92.16
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.13
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 91.93
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 91.89
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 91.7
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 90.92
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 90.86
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 90.74
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 90.51
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 90.11
1tf6_A190 Protein (transcription factor IIIA); complex (tran 90.06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 88.75
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 88.13
4f9c_B144 Protein DBF4 homolog A; Ser/Thr protein kinase, tr 87.27
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 87.19
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 87.07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 86.88
1vd4_A62 Transcription initiation factor IIE, alpha subunit 85.38
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 84.91
1vd4_A62 Transcription initiation factor IIE, alpha subunit 83.49
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
Probab=99.97  E-value=1.2e-31  Score=195.72  Aligned_cols=90  Identities=40%  Similarity=0.613  Sum_probs=62.3

Q ss_pred             hhhhhhcccCCCchHHHHhhccCcCCC-C---CCCCCCCCCCCCcccccccccccCChHHHHHHhcchhhHHHHHHhhCC
Q 033485           17 KTARLAKFLRKGDDAVYDELQRSDSAK-N---PLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGP   92 (118)
Q Consensus        17 kt~rrt~~~~kD~DqI~~dl~~~~~~~-~---~~~~dedlpg~GqfYC~~Cdr~F~~~~~l~~H~ksK~HKrrvK~l~~~   92 (118)
                      ||+||++    |+|||++||.++.... .   ++++|+|+||.++|||++|+|+|.+.++|.+|++||.|++||+.|. +
T Consensus        10 ~tkrr~r----DlDqI~~dl~~e~~~k~~~~~~~~~ded~tGekpfyC~~C~K~F~~~~~L~~H~rsK~HKrrvk~l~-~   84 (124)
T 1zr9_A           10 KAKRRRP----DLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLS-V   84 (124)
T ss_dssp             ------------------------------CCSCSSCSSSGGGGCSEETTTTEECSSHHHHHHHTTCHHHHHHHHHHT-S
T ss_pred             hhcccCC----CHHHHHHHHHhHHHHHhhccccccccccCCCCcceEcccCcchhCCHHHHHHHHhhhhhhHHHHHhc-c
Confidence            6677776    9999999997655332 3   7899999999999999999999999999999999999999999998 6


Q ss_pred             CCCCHHHHHHhcCCCCCCC
Q 033485           93 KPHTQLDADLAAGMGMPDN  111 (118)
Q Consensus        93 ~pytq~eAe~aag~g~~dn  111 (118)
                      .||||+|||+|||||++..
T Consensus        85 ~p~Tq~eAe~aag~g~~~~  103 (124)
T 1zr9_A           85 EPYSQEEAERAAGMGSYVP  103 (124)
T ss_dssp             CSSCTTTSSCSCCCCCCC-
T ss_pred             CCCcHHHHHHhccCCCCCC
Confidence            7999999999999998443



>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d1zr9a167 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 8e-28
d2vrda161 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human 7e-05
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: HkH motif-containing C2H2 finger
domain: Zinc finger protein 593, ZNF593
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 94.8 bits (236), Expect = 8e-28
 Identities = 29/61 (47%), Positives = 41/61 (67%), Gaps = 1/61 (1%)

Query: 47  PFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGM 106
            FD DLPG G + CL C RYF   +    HF++K HKKR+K+ +  +P++Q +A+ AAGM
Sbjct: 5   EFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQ-LSVEPYSQEEAERAAGM 63

Query: 107 G 107
           G
Sbjct: 64  G 64


>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 99.97
d2vrda161 Spliceosomal protein U1C {Human (Homo sapiens) [Ta 98.72
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 97.94
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 97.22
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 96.96
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 96.89
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 96.86
d2cota238 Zinc finger and SCAN domain-containing protein 16, 96.81
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 96.79
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.77
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.77
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 96.75
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 96.66
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.37
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.21
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.17
d1zu1a172 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 96.16
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.13
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 96.13
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.99
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.94
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 95.84
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.74
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.47
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.39
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 95.3
d1y0jb136 U-shaped transcription factor, different fingers { 95.0
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.68
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 94.39
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.29
d1fu9a_36 U-shaped transcription factor, different fingers { 93.92
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 93.79
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 93.6
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 92.87
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 92.84
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.74
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 92.1
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.45
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.0
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 87.85
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 85.81
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 85.22
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 82.29
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 82.21
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 81.35
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: HkH motif-containing C2H2 finger
domain: Zinc finger protein 593, ZNF593
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=5.6e-32  Score=178.07  Aligned_cols=64  Identities=45%  Similarity=0.775  Sum_probs=61.3

Q ss_pred             CCCCCCCCCCCCCcccccccccccCChHHHHHHhcchhhHHHHHHhhCCCCCCHHHHHHhcCCCC
Q 033485           44 NPLPFDEDLPGMGQYYCLHCDRYFAHESVRDEHFKTKRHKKRVKEMMGPKPHTQLDADLAAGMGM  108 (118)
Q Consensus        44 ~~~~~dedlpg~GqfYC~~Cdr~F~~~~~l~~H~ksK~HKrrvK~l~~~~pytq~eAe~aag~g~  108 (118)
                      .++++|+|+||+|||||++|+|||+|+++|++|++||+|||||++|+ ++||||+|||+|||||+
T Consensus         2 ~~~e~D~D~pG~gqfYCv~C~K~F~se~~l~~H~ksKkHKrrvk~L~-~~p~t~~eae~AaG~Gs   65 (67)
T d1zr9a1           2 PNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLS-VEPYSQEEAERAAGMGS   65 (67)
T ss_dssp             CSCSSCSSSGGGGCSEETTTTEECSSHHHHHHHTTCHHHHHHHHHHT-SCSSCTTTSSCSCCCCC
T ss_pred             CCCCCCCCCCCCCEEecccccCccCCHHHHHHHHcccHHHHHHHHhc-cCcCCHHHHHHhcCCcC
Confidence            36899999999999999999999999999999999999999999998 57999999999999996



>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure