Citrus Sinensis ID: 033515

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPCKEENQQY
cccccccccHHHHHHHccccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHccccHHcHHHHHHHHHHHcccccEEEEcccccHHHHHccccEEEccccccccccccc
***S*SYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVP********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPCKEENQQY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual specificity phosphatase Cdc25 Arsenate reductase that plays a major role in the reduction of arsenate to arsenite and arsenic retention in roots.probableQ8GY31
Arsenate reductase 2.1 Possesses phosphatase activity towards p-nitrophenyl phosphate in vitro.probableQ336V5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T3K, chain A
Confidence level:very confident
Coverage over the Query: 2-115
View the alignment between query and template
View the model in PyMOL