Citrus Sinensis ID: 033544


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MALKLACAVLLMCMVMGAPIAQAAVTCGQVTSSLQACIPYVTGPRGGAVPPACCSGIKSLNSAATTTPDRQSVCNCLKTAAGSIKNLNLNLASRLPRQCGVNIPYQISPSVDCSRVR
cHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccHHHHcccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccccc
*ALKLACAVLLMCMVMGAPIAQAAVTCGQVTSSLQACIPYVTGPRGGAVPPACCSGIKSLNSAATTTPDRQSVCNCLKTAAGSIKNLNLNLASRLPRQCGVNIPYQISPSVDC****
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALKLACAVLLMCMVMGAPIAQAAVTCGQVTSSLQACIPYVTGPRGGAVPPACCSGIKSLNSAATTTPDRQSVCNCLKTAAGSIKNLNLNLASRLPRQCGVNIPYQISPSVDCSRVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Non-specific lipid-transfer protein 2B Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.probableQ2QYL2
Non-specific lipid-transfer protein 1 Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.probableQ42589
Non-specific lipid-transfer protein 1 Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. Binds cis-unsaturated fatty acids and jasmonic acid with a higher affinity than linear chain fatty acids. Formation of the complex with jasmonic acid results in a conformational change facilitating the LPT1 binding on the elicitin plasma membrane receptor that is known to be involved in plant defense induction. May also play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.probableQ42952

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SIY, chain A
Confidence level:very confident
Coverage over the Query: 25-117
View the alignment between query and template
View the model in PyMOL