Citrus Sinensis ID: 033568

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLCHAEIVSVGPANKPEGKKKKDDDEKKKEDDEKKKIAELVRGYGAYKVLGAANACVIC
cEEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEccHHHHHHHHHHcccEEEEEEccccccccccccccHHHccccHHHHHHHHHHcccccccccccccccccc
ccEEEEEEEcccHHHHHHHHHHHHccccccEEEEEcccccEEEEEcccHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEc
MKKAVFKVGVDDKKARTKVLKTMVGlagvdtasmdekekkltvigdIDLVSLVSKLKKLCHAEIvsvgpankpegkkkkdddekkkEDDEKKKIAELVRGYGAYKVLGaanacvic
mkkavfkvgvddkkartkvlktmvglagvdtasmdekekkltvigdidLVSLVSKLKKLCHAeivsvgpankpegkkkkdddekkkeddekkkiaelvrgygaykvlgaanacvic
MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDlvslvsklkklCHAEIVSVGPANKPEGkkkkdddekkkeddekkkIAELVRGYGAYKVLGAANACVIC
***************RTKVLKTMVGLAGVDTA*****EKKLTVIGDIDLVSLVSKLKKLCHAEIVSV**************************IAELVRGYGAYKVLGAANACVI*
MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLCHAEIV********************************VRGYGAYKVLGAANACVIC
MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLCHAEIVSVGPA********************KKKIAELVRGYGAYKVLGAANACVIC
MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLCHAEIVSVGPANK**************EDDEKKKIAELVRGYGAYKVLGAANACVIC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLCHAEIVSVGPANKPEGKKKKDDDEKKKEDDEKKKIAELVRGYGAYKVLGAANACVIC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query116 2.2.26 [Sep-21-2011]
Q6L4031312 Putative late blight resi N/A no 0.5 0.044 0.393 0.0008
>sp|Q6L403|R1B17_SOLDE Putative late blight resistance protein homolog R1B-17 OS=Solanum demissum GN=R1B-17 PE=3 SV=1 Back     alignment and function desciption
 Score = 42.4 bits (98), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 3/61 (4%)

Query: 1    MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDID---LVSLVSKLK 57
            +KK ++KV V   K R +  K +  L G+ + + D  +KKLTV GD+D   +  +VSKL+
Sbjct: 1248 IKKMMWKVDVGVNKGRLETFKRLAPLPGIKSVAFDFNKKKLTVTGDMDANEVQLVVSKLR 1307

Query: 58   K 58
            K
Sbjct: 1308 K 1308
Confers resistance to late blight (Phytophthora infestans) races carrying the avirulence gene Avr1. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Solanum demissum (taxid: 50514)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
171451994131 hypothetical protein [Bruguiera gymnorhi 0.974 0.862 0.455 6e-20
29124977132 unknown [Populus tremuloides] 0.965 0.848 0.477 4e-19
356513345136 PREDICTED: uncharacterized protein LOC10 1.0 0.852 0.441 1e-17
224058435152 predicted protein [Populus trichocarpa] 0.991 0.756 0.427 5e-17
224077486132 predicted protein [Populus trichocarpa] 0.991 0.871 0.458 3e-16
225464598125 PREDICTED: putative late blight resistan 0.965 0.896 0.472 9e-16
83283997159 unknown [Solanum tuberosum] 0.637 0.465 0.567 2e-15
388497002127 unknown [Lotus japonicus] 0.862 0.787 0.467 2e-15
388498422133 unknown [Lotus japonicus] 1.0 0.872 0.443 2e-15
76161002160 unknown [Solanum tuberosum] 0.637 0.462 0.554 4e-15
>gi|171451994|dbj|BAG15861.1| hypothetical protein [Bruguiera gymnorhiza] Back     alignment and taxonomy information
 Score =  101 bits (251), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 82/134 (61%), Gaps = 21/134 (15%)

Query: 1   MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLC 60
           MKK + K+   D K + K ++T+ GL+GVD+ +MD KEKKLTV GD+D V +VSKL+KLC
Sbjct: 1   MKKVILKLDPRDDKIKQKAMRTVSGLSGVDSVAMDMKEKKLTVTGDVDPVHVVSKLRKLC 60

Query: 61  HAEIVSVGPANKPEGKKKKDDDEKKKE-------DDEKKKIAELVRGYGAYKVLGA---- 109
           H +IVSVGPA +PE   KK + EK+ E       D +K  ++EL++ Y AY         
Sbjct: 61  HTDIVSVGPAKEPE---KKAESEKQPEGGKKDGKDAKKDDVSELIKAYQAYNPHMTTYYY 117

Query: 110 -------ANACVIC 116
                   NACVIC
Sbjct: 118 VKSAEEDPNACVIC 131

Source: Bruguiera gymnorhiza

Species: Bruguiera gymnorhiza

Genus: Bruguiera

Family: Rhizophoraceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|29124977|gb|AAO63778.1| unknown [Populus tremuloides] Back     alignment and taxonomy information
>gi|356513345|ref|XP_003525374.1| PREDICTED: uncharacterized protein LOC100784242 [Glycine max] Back     alignment and taxonomy information
>gi|224058435|ref|XP_002299508.1| predicted protein [Populus trichocarpa] gi|222846766|gb|EEE84313.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224077486|ref|XP_002305267.1| predicted protein [Populus trichocarpa] gi|118486507|gb|ABK95093.1| unknown [Populus trichocarpa] gi|222848231|gb|EEE85778.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225464598|ref|XP_002274512.1| PREDICTED: putative late blight resistance protein homolog R1B-19 [Vitis vinifera] gi|302143783|emb|CBI22644.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|83283997|gb|ABC01906.1| unknown [Solanum tuberosum] Back     alignment and taxonomy information
>gi|388497002|gb|AFK36567.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388498422|gb|AFK37277.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|76161002|gb|ABA40464.1| unknown [Solanum tuberosum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
TAIR|locus:2025421177 AT1G01490 [Arabidopsis thalian 0.637 0.418 0.453 3.3e-13
TAIR|locus:2149584118 AT5G52740 "AT5G52740" [Arabido 0.620 0.610 0.378 2e-08
TAIR|locus:2149614126 AT5G52760 [Arabidopsis thalian 0.620 0.571 0.337 6.1e-07
TAIR|locus:2149594139 AT5G52750 [Arabidopsis thalian 0.620 0.517 0.319 7.8e-07
TAIR|locus:2149629111 AT5G52770 [Arabidopsis thalian 0.637 0.666 0.310 5.5e-06
TAIR|locus:2172808103 AT5G23760 "AT5G23760" [Arabido 0.612 0.689 0.333 7e-06
TAIR|locus:2149679185 AT5G52730 "AT5G52730" [Arabido 0.586 0.367 0.352 1.2e-05
TAIR|locus:2146834114 AT5G26690 [Arabidopsis thalian 0.629 0.640 0.310 2.4e-05
TAIR|locus:2074474126 AT3G05920 [Arabidopsis thalian 0.629 0.579 0.297 0.00045
TAIR|locus:2195493113 AT1G63950 [Arabidopsis thalian 0.353 0.362 0.390 0.00073
TAIR|locus:2025421 AT1G01490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 148 (57.2 bits), Expect = 3.3e-13, Sum P(2) = 3.3e-13
 Identities = 34/75 (45%), Positives = 45/75 (60%)

Query:     1 MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDXXXXXXXXXXXC 60
             MKK V K+ + D +A+ K LKT+  L G+D+ +MD KEKKLTVIG +D            
Sbjct:     1 MKKIVLKLDLHDDRAKQKALKTVSTLPGIDSIAMDMKEKKLTVIGTVDPVNVVSKLRKYW 60

Query:    61 H-AEIVSVGPANKPE 74
                +IV VGPA +PE
Sbjct:    61 PMTDIVLVGPAKEPE 75
GO:0005634 "nucleus" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA;ISS
TAIR|locus:2149584 AT5G52740 "AT5G52740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149614 AT5G52760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149594 AT5G52750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149629 AT5G52770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172808 AT5G23760 "AT5G23760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149679 AT5G52730 "AT5G52730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146834 AT5G26690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074474 AT3G05920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195493 AT1G63950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_I000880
hypothetical protein (152 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 0.002
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information 
 Score = 33.7 bits (78), Expect = 0.002
 Identities = 18/59 (30%), Positives = 27/59 (45%)

Query: 4  AVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLCHA 62
           +   G+       KV K +  L GV + S+D +  K+TV GD D + L    K +  A
Sbjct: 1  TLRVPGMTCAGCAKKVEKALSKLPGVSSVSVDLETGKVTVTGDPDPLKLEKLKKAIEKA 59

Length = 62

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.71
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.5
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.34
KOG4656 247 consensus Copper chaperone for superoxide dismutas 98.78
PLN02957 238 copper, zinc superoxide dismutase 98.47
PRK10671 834 copA copper exporting ATPase; Provisional 98.42
TIGR0000368 copper ion binding protein. This model describes a 97.79
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.34
PRK10671 834 copA copper exporting ATPase; Provisional 96.74
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 96.72
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 96.3
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 95.32
COG188897 Uncharacterized protein conserved in archaea [Func 93.5
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 93.14
TIGR0205292 MerP mercuric transport protein periplasmic compon 82.78
PF0188372 DUF59: Domain of unknown function DUF59; InterPro: 81.53
PRK13748 561 putative mercuric reductase; Provisional 81.05
PF1373284 DUF4162: Domain of unknown function (DUF4162) 80.33
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.71  E-value=5.3e-17  Score=106.09  Aligned_cols=65  Identities=34%  Similarity=0.488  Sum_probs=60.0

Q ss_pred             CeEEEEEEeccchhhHHHHHHHHhCCCCccEEEeeCCCCeEEEEeeCCHHHHHHHHHhcC-CeEEE
Q 033568            1 MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLC-HAEIV   65 (116)
Q Consensus         1 M~kvvlKV~m~C~~C~~kv~k~ls~l~GV~sV~vD~~~~kvtV~G~vDp~~lv~~LrK~g-~aeiv   65 (116)
                      |++.+++|+|||++|.++|++.++.+.||.++.+|.++++|||.|.+||..|+++|+|.+ +...+
T Consensus         4 ~~~~v~kv~~~C~gc~~kV~~~l~~~~GV~~v~id~~~~kvtV~g~~~p~~vl~~l~k~~~k~~~~   69 (73)
T KOG1603|consen    4 IKTVVLKVNMHCEGCARKVKRVLQKLKGVESVDIDIKKQKVTVKGNVDPVKLLKKLKKTGGKRAEL   69 (73)
T ss_pred             ccEEEEEECcccccHHHHHHHHhhccCCeEEEEecCCCCEEEEEEecCHHHHHHHHHhcCCCceEE
Confidence            578899999999999999999999999999999999999999999999999999999976 44333

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>COG1888 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>PF01883 DUF59: Domain of unknown function DUF59; InterPro: IPR002744 This family includes prokaryotic proteins of unknown function Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PF13732 DUF4162: Domain of unknown function (DUF4162) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.65
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.56
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.5
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.45
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.42
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.4
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.28
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.27
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.26
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.25
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 99.22
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.22
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 99.21
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 99.2
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.19
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.18
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.15
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 99.15
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.15
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 99.11
2kyz_A67 Heavy metal binding protein; structural genomics, 99.11
1opz_A76 Potential copper-transporting ATPase; mutation, fo 99.09
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.09
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 99.08
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 99.08
1yg0_A66 COP associated protein; open-faced beta-sandwich, 99.07
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 99.06
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 99.06
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 99.06
2kkh_A95 Putative heavy metal transporter; zinc transport, 99.04
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.04
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 99.01
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.99
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.97
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.97
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.93
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.93
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.85
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.64
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.49
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.2
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 93.64
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 93.12
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 93.05
2jsx_A95 Protein NAPD; TAT, proofreading, cytoplasm, chaper 80.45
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.65  E-value=6.6e-16  Score=95.84  Aligned_cols=66  Identities=23%  Similarity=0.304  Sum_probs=62.7

Q ss_pred             CeEEEEEEeccchhhHHHHHHHHhCCCCccEEEeeCCCCeEEEEeeCCHHHHHHHHHhcC-CeEEEee
Q 033568            1 MKKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLC-HAEIVSV   67 (116)
Q Consensus         1 M~kvvlKV~m~C~~C~~kv~k~ls~l~GV~sV~vD~~~~kvtV~G~vDp~~lv~~LrK~g-~aeivsv   67 (116)
                      |++++|+|+|+|.+|.+++.++|.+++|| ++.+|+.+++++|.|++++..|.++|++.| .+.++++
T Consensus         1 m~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~~~Gy~~~~~~~   67 (68)
T 3iwl_A            1 MPKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL   67 (68)
T ss_dssp             -CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTCSCEEEEEC
T ss_pred             CceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEecCCHHHHHHHHHHcCCceEecCC
Confidence            78999999999999999999999999999 999999999999999999999999999999 8988864
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure
>2jsx_A Protein NAPD; TAT, proofreading, cytoplasm, chaperone; NMR {Escherichia coli K12} PDB: 2pq4_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.71
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.71
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.68
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.56
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.55
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.54
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.5
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.48
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.47
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.47
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.39
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.38
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.37
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.36
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 93.64
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 93.2
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Human (Homo sapiens), HAH1 [TaxId: 9606]

Probab=99.71  E-value=1.7e-17  Score=104.39  Aligned_cols=64  Identities=22%  Similarity=0.294  Sum_probs=60.9

Q ss_pred             EEEEEEeccchhhHHHHHHHHhCCCCccEEEeeCCCCeEEEEeeCCHHHHHHHHHhcC-CeEEEee
Q 033568            3 KAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKLKKLC-HAEIVSV   67 (116)
Q Consensus         3 kvvlKV~m~C~~C~~kv~k~ls~l~GV~sV~vD~~~~kvtV~G~vDp~~lv~~LrK~g-~aeivsv   67 (116)
                      +..|+|+|||.+|.++|.++|.+++|| ++.+|+.+++++|.|++++..|+++|+++| .|+++.+
T Consensus         2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~~~~~~i~~~I~~~Gy~a~lig~   66 (66)
T d1fe0a_           2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL   66 (66)
T ss_dssp             EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTTSCEEEEEC
T ss_pred             CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEeeCCHHHHHHHHHHhCCeEEEeeC
Confidence            578999999999999999999999998 699999999999999999999999999999 9999864
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure