Citrus Sinensis ID: 033572


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MAARIIAQLIVMGSGIMARAVVQAYRQALANASKSGVAQETVQNIRRASKMMAEPEARQILGVTEQSSWEEILKKYDNLFEQNAKNGSFYLQSKVHRAKECLETVYQKKHQGTEDS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccc
*AARIIAQLIVMGSGIMARAVVQAYRQAL****************************RQILGVTEQSSWEEILKKYDNLFEQNAKNGSFYLQSKVHRAKECLETVY**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAARIIAQLIVMGSGIMARAVVQAYRQALANASKSGVAQETVQNIRRASKMMAEPEARQILGVTEQSSWEEILKKYDNLFEQNAKNGSFYLQSKVHRAKECLETVYQKKHQGTEDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import inner membrane translocase subunit TIM16 Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation.probableQ6BXP3
Mitochondrial import inner membrane translocase subunit tim16 Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (ssc1) via its interaction with PAM18/TIM14. May act by positioning pam18/tim14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation.probableQ9C1W5
Mitochondrial import inner membrane translocase subunit tim16 Regulates ATP-dependent protein translocation into the mitochondrial matrix.probableQ54SV6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GUZ, chain B
Confidence level:very confident
Coverage over the Query: 52-110
View the alignment between query and template
View the model in PyMOL