Citrus Sinensis ID: 033593


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MDTCPSIKNILLLDSEGKRVAVKYYSNDWPTNSAKEAFEKAVFTKTQKTNARTEAEIAMLEGNVIVYKFVQDLHFFVTGGEDENELILATVLQGFFDAVGLLLRLLHYVIVYFLI
ccccccEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccEEEEccEEEEEEEEcEEEEEEECcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEc
*DTCPSIKNILLLDSEGKRVAVKYYSNDWPTNSAKEAFEKAVFTKTQKTNARTEAEIAMLEGNVIVYKFVQDLHFFVTGGEDENELILATVLQGFFDAVGLLLRLLHYVIVYFLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTCPSIKNILLLDSEGKRVAVKYYSNDWPTNSAKEAFEKAVFTKTQKTNARTEAEIAMLEGNVIVYKFVQDLHFFVTGGEDENELILATVLQGFFDAVGLLLRLLHYVIVYFLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coatomer subunit zeta-2 The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.probableQ84LG4
Coatomer subunit zeta-1 The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.probableQ940S5
Coatomer subunit zeta-1 The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.probableQ9MAX5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TJZ, chain C
Confidence level:very confident
Coverage over the Query: 2-106
View the alignment between query and template
View the model in PyMOL