Citrus Sinensis ID: 033597

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF
ccEEEEEEcccccHHcHHHHHHHHHHHHHHHHccccccEEEEEEccEEEEEccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccEEccccc
ccEEEEEEcccccHHccccHHHHHHHHHHHHHcccHHHcEEEEEcccEEEEccEccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEccHHHEEEccEEc
mptlnlytnvpvdavIASDILRDATKAVAKILGKSESYVMILINGgvpiafagteapaaygelisigslgpsvngklSSTIAEILQTKLLIDSSRFYIKLYDversffgfngstf
mptlnlytnvpvdaviasdiLRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF
MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF
***LNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGF*****
MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF
MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF
MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
P91850115 Macrophage migration inhi N/A no 0.991 0.991 0.443 4e-20
O44786115 Macrophage migration inhi N/A no 0.991 0.991 0.443 1e-19
P81748114 Macrophage migration inhi N/A no 0.991 1.0 0.434 3e-19
P81529114 Macrophage migration inhi N/A no 0.991 1.0 0.382 1e-13
Q76BK2115 Macrophage migration inhi N/A no 0.991 0.991 0.365 1e-12
Q02960115 Macrophage migration inhi yes no 0.991 0.991 0.330 3e-12
A9JSE7115 Macrophage migration inhi yes no 0.991 0.991 0.347 1e-11
P34884115 Macrophage migration inhi yes no 0.991 0.991 0.339 2e-11
P30904115 Macrophage migration inhi yes no 0.991 0.991 0.339 2e-11
P80928115 Macrophage migration inhi yes no 0.991 0.991 0.330 2e-11
>sp|P91850|MIFH_BRUMA Macrophage migration inhibitory factor homolog OS=Brugia malayi GN=Bm1_28435 PE=3 SV=4 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (60%), Gaps = 1/115 (0%)

Query: 1   MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAY 60
           MP   + TN+P ++ I+S  L+ A+  VAK LGK ESYV I +NGG  + F G+E P A 
Sbjct: 1   MPYFTIDTNIPQNS-ISSAFLKKASNVVAKALGKPESYVSIHVNGGQAMVFGGSEDPCAV 59

Query: 61  GELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF 115
             L SIG +GP VN   +  + ++L  +L I  +R YI+  D+E S   FNGSTF
Sbjct: 60  CVLKSIGCVGPKVNNSHAEKLYKLLADELKIPKNRCYIEFVDIEASSMAFNGSTF 114
Tautomerization of the methyl ester of L-dopachrome (By similarity). Inhibits migration of human peripheral blood mononuclear cells.
Brugia malayi (taxid: 6279)
EC: 5EC: .EC: 3EC: .EC: 3EC: .EC: 1EC: 2
>sp|O44786|MIFH_WUCBA Macrophage migration inhibitory factor homolog OS=Wuchereria bancrofti GN=MIF PE=3 SV=3 Back     alignment and function description
>sp|P81748|MIFH_TRITR Macrophage migration inhibitory factor homolog OS=Trichuris trichiura PE=1 SV=2 Back     alignment and function description
>sp|P81529|MIFH_TRISP Macrophage migration inhibitory factor homolog OS=Trichinella spiralis PE=1 SV=2 Back     alignment and function description
>sp|Q76BK2|MIF_XENLA Macrophage migration inhibitory factor OS=Xenopus laevis GN=mif PE=1 SV=1 Back     alignment and function description
>sp|Q02960|MIF_CHICK Macrophage migration inhibitory factor OS=Gallus gallus GN=MIF PE=2 SV=3 Back     alignment and function description
>sp|A9JSE7|MIF_XENTR Macrophage migration inhibitory factor OS=Xenopus tropicalis GN=mif PE=3 SV=1 Back     alignment and function description
>sp|P34884|MIF_MOUSE Macrophage migration inhibitory factor OS=Mus musculus GN=Mif PE=1 SV=2 Back     alignment and function description
>sp|P30904|MIF_RAT Macrophage migration inhibitory factor OS=Rattus norvegicus GN=Mif PE=1 SV=4 Back     alignment and function description
>sp|P80928|MIF_PIG Macrophage migration inhibitory factor OS=Sus scrofa GN=MIF PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
357479527 855 Macrophage migration inhibitory factor-l 1.0 0.134 0.869 2e-52
388499576115 unknown [Lotus japonicus] gi|388509712|g 1.0 1.0 0.886 2e-52
351726816115 uncharacterized protein LOC100306650 [Gl 1.0 1.0 0.886 3e-52
225445945115 PREDICTED: macrophage migration inhibito 1.0 1.0 0.869 8e-52
388517853115 unknown [Medicago truncatula] 1.0 1.0 0.869 1e-50
255573572115 light-inducible protein atls1, putative 1.0 1.0 0.852 2e-50
449457199115 PREDICTED: macrophage migration inhibito 1.0 1.0 0.817 1e-47
312282181115 unnamed protein product [Thellungiella h 1.0 1.0 0.817 2e-47
297796609115 macrophage migration inhibitory factor f 1.0 1.0 0.817 2e-47
15242048115 macrophage migration inhibitory factor f 1.0 1.0 0.817 3e-47
>gi|357479527|ref|XP_003610049.1| Macrophage migration inhibitory factor-like protein [Medicago truncatula] gi|355511104|gb|AES92246.1| Macrophage migration inhibitory factor-like protein [Medicago truncatula] Back     alignment and taxonomy information
 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 100/115 (86%), Positives = 105/115 (91%)

Query: 1   MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAY 60
           MPTLNL+TN+PVD VIASDILRDATK VAKI+GK ESYVMIL+NGGVPIAF GTE PAAY
Sbjct: 741 MPTLNLFTNIPVDPVIASDILRDATKVVAKIIGKPESYVMILLNGGVPIAFGGTEEPAAY 800

Query: 61  GELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF 115
           GELISIG LGPSVN KLSSTIA+ILQTKL IDSSRFYIK YD ERSFFGFNGSTF
Sbjct: 801 GELISIGGLGPSVNAKLSSTIAQILQTKLYIDSSRFYIKFYDSERSFFGFNGSTF 855

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388499576|gb|AFK37854.1| unknown [Lotus japonicus] gi|388509712|gb|AFK42922.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|351726816|ref|NP_001238163.1| uncharacterized protein LOC100306650 [Glycine max] gi|255629183|gb|ACU14936.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225445945|ref|XP_002264373.1| PREDICTED: macrophage migration inhibitory factor homolog [Vitis vinifera] gi|297735476|emb|CBI17916.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388517853|gb|AFK46988.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255573572|ref|XP_002527710.1| light-inducible protein atls1, putative [Ricinus communis] gi|223532900|gb|EEF34669.1| light-inducible protein atls1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449457199|ref|XP_004146336.1| PREDICTED: macrophage migration inhibitory factor homolog [Cucumis sativus] gi|449528921|ref|XP_004171450.1| PREDICTED: macrophage migration inhibitory factor homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|312282181|dbj|BAJ33956.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|297796609|ref|XP_002866189.1| macrophage migration inhibitory factor family protein [Arabidopsis lyrata subsp. lyrata] gi|297312024|gb|EFH42448.1| macrophage migration inhibitory factor family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15242048|ref|NP_200527.1| macrophage migration inhibitory factor family protein [Arabidopsis thaliana] gi|8843819|dbj|BAA97367.1| light-inducible protein ATLS1-like [Arabidopsis thaliana] gi|26453248|dbj|BAC43697.1| putative light-inducible protein ATLS1 [Arabidopsis thaliana] gi|28416857|gb|AAO42959.1| At5g57170 [Arabidopsis thaliana] gi|332009475|gb|AED96858.1| macrophage migration inhibitory factor family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
TAIR|locus:2149830122 AT5G01650 "AT5G01650" [Arabido 0.904 0.852 0.567 4.5e-27
TAIR|locus:2098272112 AT3G51660 "AT3G51660" [Arabido 0.895 0.919 0.378 1.3e-15
UNIPROTKB|Q02960115 MIF "Macrophage migration inhi 0.991 0.991 0.330 1.9e-12
UNIPROTKB|P80928115 MIF "Macrophage migration inhi 0.991 0.991 0.330 3.9e-12
MGI|MGI:96982115 Mif "macrophage migration inhi 0.991 0.991 0.339 3.9e-12
RGD|621163115 Mif "macrophage migration inhi 0.991 0.991 0.339 3.9e-12
UNIPROTKB|O55052115 MIF "Macrophage migration inhi 0.991 0.991 0.330 8.2e-12
UNIPROTKB|P14174115 MIF "Macrophage migration inhi 0.991 0.991 0.330 1.7e-11
UNIPROTKB|Q4R549115 MIF "Macrophage migration inhi 0.991 0.991 0.330 1.7e-11
UNIPROTKB|Q6DN04115 MIF "Macrophage migration inhi 0.991 0.991 0.330 1.7e-11
TAIR|locus:2149830 AT5G01650 "AT5G01650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 304 (112.1 bits), Expect = 4.5e-27, P = 4.5e-27
 Identities = 59/104 (56%), Positives = 77/104 (74%)

Query:     1 MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAY 60
             MP LNL TNV +D V  S IL +A+  VAKI+GK E+YVMI++ G VP++F GTE PAAY
Sbjct:     1 MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKGSVPMSFGGTEDPAAY 60

Query:    61 GELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVE 104
             GEL+SIG L   VN KLS+ ++ IL+TKL +  SRF++K YD +
Sbjct:    61 GELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK 104
GO:0003674 "molecular_function" evidence=ND
GO:0006954 "inflammatory response" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0051707 "response to other organism" evidence=ISS
TAIR|locus:2098272 AT3G51660 "AT3G51660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q02960 MIF "Macrophage migration inhibitory factor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P80928 MIF "Macrophage migration inhibitory factor" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:96982 Mif "macrophage migration inhibitory factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621163 Mif "macrophage migration inhibitory factor (glycosylation-inhibiting factor)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O55052 MIF "Macrophage migration inhibitory factor" [Meriones unguiculatus (taxid:10047)] Back     alignment and assigned GO terms
UNIPROTKB|P14174 MIF "Macrophage migration inhibitory factor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R549 MIF "Macrophage migration inhibitory factor" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DN04 MIF "Macrophage migration inhibitory factor" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6DN04MIF_MACMU5, ., 3, ., 3, ., 1, 20.33040.99130.9913yesno
P14174MIF_HUMAN5, ., 3, ., 3, ., 1, 20.33040.99130.9913yesno
P80928MIF_PIG5, ., 3, ., 3, ., 1, 20.33040.99130.9913yesno
Q02960MIF_CHICK5, ., 3, ., 3, ., 1, 20.33040.99130.9913yesno
P34884MIF_MOUSE5, ., 3, ., 3, ., 1, 20.33910.99130.9913yesno
A9JSE7MIF_XENTR5, ., 3, ., 3, ., 1, 20.34780.99130.9913yesno
P30904MIF_RAT5, ., 3, ., 3, ., 1, 20.33910.99130.9913yesno
P80177MIF_BOVIN5, ., 3, ., 3, ., 1, 20.32170.99130.9913yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.120.914
3rd Layer5.3.30.921
3rd Layer5.3.2.10.914
3rd Layer5.3.20.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
pfam01187114 pfam01187, MIF, Macrophage migration inhibitory fa 3e-23
PTZ00397116 PTZ00397, PTZ00397, macrophage migration inhibitio 6e-16
PTZ00450113 PTZ00450, PTZ00450, macrophage migration inhibitor 2e-11
>gnl|CDD|201647 pfam01187, MIF, Macrophage migration inhibitory factor (MIF) Back     alignment and domain information 
 Score = 85.9 bits (213), Expect = 3e-23
 Identities = 38/114 (33%), Positives = 60/114 (52%), Gaps = 1/114 (0%)

Query: 2   PTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYG 61
           P   + TN+P ++V    + +  T+ +AK LGK E  + + I  G  + F G+  P A  
Sbjct: 1   PMFEVDTNLPANSV-PDGLEKRLTQQLAKALGKPEQRIAVHIVPGQAMVFGGSTEPCAVC 59

Query: 62  ELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF 115
            L SIG +G   N   S+ + + L  +L +   R YI  +D+E +  GFNG+TF
Sbjct: 60  SLKSIGKVGAEQNRSHSALLCKFLTKELSLPKDRIYINFFDLEAANVGFNGTTF 113

Length = 114
>gnl|CDD|240401 PTZ00397, PTZ00397, macrophage migration inhibition factor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185629 PTZ00450, PTZ00450, macrophage migration inhibitory factor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
PTZ00450113 macrophage migration inhibitory factor-like protei 100.0
PF01187114 MIF: Macrophage migration inhibitory factor (MIF); 100.0
PTZ00397116 macrophage migration inhibition factor-like protei 100.0
KOG1759115 consensus Macrophage migration inhibitory factor [ 100.0
PF1455282 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AA 99.53
cd0049158 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tauto 99.53
PRK0196464 4-oxalocrotonate tautomerase; Provisional 99.52
PRK0222061 4-oxalocrotonate tautomerase; Provisional 99.52
PF0136160 Tautomerase: Tautomerase enzyme; InterPro: IPR0043 99.52
TIGR0001363 taut 4-oxalocrotonate tautomerase family enzyme. 4 99.51
PRK0074562 4-oxalocrotonate tautomerase; Provisional 99.48
COG194269 Uncharacterized protein, 4-oxalocrotonate tautomer 99.32
PRK0228960 4-oxalocrotonate tautomerase; Provisional 99.32
cd00580113 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase ( 99.27
PF08921108 DUF1904: Domain of unknown function (DUF1904); Int 99.21
PF14832136 Tautomerase_3: Putative oxalocrotonate tautomerase 99.09
PRK0127176 4-oxalocrotonate tautomerase; Provisional 99.06
PRK0196464 4-oxalocrotonate tautomerase; Provisional 99.0
PRK0228960 4-oxalocrotonate tautomerase; Provisional 98.98
PRK0074562 4-oxalocrotonate tautomerase; Provisional 98.96
PRK0222061 4-oxalocrotonate tautomerase; Provisional 98.95
COG194269 Uncharacterized protein, 4-oxalocrotonate tautomer 98.87
PRK15031126 5-carboxymethyl-2-hydroxymuconate delta-isomerase; 98.82
PRK0127176 4-oxalocrotonate tautomerase; Provisional 98.72
PF0136160 Tautomerase: Tautomerase enzyme; InterPro: IPR0043 98.71
cd0049158 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tauto 98.65
TIGR0001363 taut 4-oxalocrotonate tautomerase family enzyme. 4 98.63
PF02962124 CHMI: 5-carboxymethyl-2-hydroxymuconate isomerase; 98.29
PTZ00397116 macrophage migration inhibition factor-like protei 97.83
COG3232127 HpaF 5-carboxymethyl-2-hydroxymuconate isomerase [ 97.75
PF1455282 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AA 97.55
PF14832136 Tautomerase_3: Putative oxalocrotonate tautomerase 97.21
PTZ00450113 macrophage migration inhibitory factor-like protei 96.48
PF01187114 MIF: Macrophage migration inhibitory factor (MIF); 96.17
cd00580113 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase ( 94.18
TIGR02544193 III_secr_YscJ type III secretion apparatus lipopro 93.49
TIGR02830186 spore_III_AG stage III sporulation protein AG. CC 92.09
KOG1759115 consensus Macrophage migration inhibitory factor [ 91.77
PF09581188 Spore_III_AF: Stage III sporulation protein AF (Sp 88.63
cd00673232 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II 88.05
PF0259477 DUF167: Uncharacterised ACR, YggU family COG1872; 87.32
PF08921108 DUF1904: Domain of unknown function (DUF1904); Int 87.1
PF1109086 DUF2833: Protein of unknown function (DUF2833); In 86.27
PRK0509095 hypothetical protein; Validated 84.26
PRK15348249 type III secretion system lipoprotein SsaJ; Provis 84.23
COG3887 655 Predicted signaling protein consisting of a modifi 83.37
PRK0064796 hypothetical protein; Validated 82.36
PRK01310104 hypothetical protein; Validated 82.07
PRK01530105 hypothetical protein; Reviewed 81.12
COG0245159 IspF 2C-methyl-D-erythritol 2,4-cyclodiphosphate s 80.89
>PTZ00450 macrophage migration inhibitory factor-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1e-44  Score=226.91  Aligned_cols=112  Identities=29%  Similarity=0.509  Sum_probs=104.4

Q ss_pred             CCeEEEEeCCCCCccCHHHHHHHHHH-HHHHHhCCCcceeEEEEeCCceEEeccCCCceeEEEEEeecCCChhhhHHHHH
Q 033597            1 MPTLNLYTNVPVDAVIASDILRDATK-AVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSS   79 (115)
Q Consensus         1 MP~i~i~tn~~~~~~~~~~~~~~l~~-~~a~~~~kp~~~i~v~~~~~~~~~~gg~~~p~~~v~i~~~~~~~~~~~~~~~~   79 (115)
                      ||+++|+||++.++++ ++++++.++ ++++++||||+|+||++++++.|+|||+++||||++|+++|++++++|+++++
T Consensus         1 MP~~~i~tNv~~~~~~-~~~l~~~~~~~~a~~lgKPe~yvmV~~~~~~~m~fgGs~~P~A~~~l~siG~~~~~~n~~~s~   79 (113)
T PTZ00450          1 MPFLQTIVSVSLDDQK-RANLSQAYRMICREELGKPEDFVMTAFSDSTPMSFQGSTAPAAYVRVEAWGEYAPSKPKMMTP   79 (113)
T ss_pred             CCEEEEEecCCCcccC-HHHHHHHHHHHHHHhhCCCHHHEEEEEeCCceEEEcCCCCCEEEEEEEEecCcCHHHHHHHHH
Confidence            9999999999988874 566666655 66699999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhHhCCCCCceEEEEEecCCCCceecCccC
Q 033597           80 TIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF  115 (115)
Q Consensus        80 ~i~~~l~~~Lgv~~~ri~i~f~~~~~~~~g~~G~t~  115 (115)
                      +|+++++++||||++||||.|+|.  ++|||||+||
T Consensus        80 ~i~~~l~~~LgIp~dRiYI~f~d~--~~~G~nG~tF  113 (113)
T PTZ00450         80 RITAAITKECGIPAERIYVFYYST--KHCGWNGTNF  113 (113)
T ss_pred             HHHHHHHHHcCCCcccEEEEEEcH--HHcccCcEeC
Confidence            999999999999999999999995  7899999998

>PF01187 MIF: Macrophage migration inhibitory factor (MIF); InterPro: IPR001398 Macrophage migration inhibitory factor (MIF) is a key regulatory cytokine within innate and adaptive immune responses, capable of promoting and modulating the magnitude of the response [] Back     alignment and domain information
>PTZ00397 macrophage migration inhibition factor-like protein; Provisional Back     alignment and domain information
>KOG1759 consensus Macrophage migration inhibitory factor [Defense mechanisms] Back     alignment and domain information
>PF14552 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C Back     alignment and domain information
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase: Catalyzes the isomerization of unsaturated ketones Back     alignment and domain information
>PRK01964 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK02220 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PF01361 Tautomerase: Tautomerase enzyme; InterPro: IPR004370 4-Oxalocrotonate tautomerase (4-OT) catalyzes the isomerisation of beta,gamma-unsaturated enones to their alpha,beta-isomers Back     alignment and domain information
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme Back     alignment and domain information
>PRK00745 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>COG1942 Uncharacterized protein, 4-oxalocrotonate tautomerase homolog [General function prediction only] Back     alignment and domain information
>PRK02289 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>cd00580 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) is a trimeric enzyme catalyzing the isomerization of the unsaturated ketone 5-(carboxymethyl)-2-hydroxymuconate to 5-(carboxymethyl)-2-oxo-3-hexene-1,6-dionate Back     alignment and domain information
>PF08921 DUF1904: Domain of unknown function (DUF1904); InterPro: IPR015017 This entry represents a family of hypothetical bacterial proteins Back     alignment and domain information
>PF14832 Tautomerase_3: Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A Back     alignment and domain information
>PRK01271 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK01964 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK02289 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK00745 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK02220 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>COG1942 Uncharacterized protein, 4-oxalocrotonate tautomerase homolog [General function prediction only] Back     alignment and domain information
>PRK15031 5-carboxymethyl-2-hydroxymuconate delta-isomerase; Provisional Back     alignment and domain information
>PRK01271 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PF01361 Tautomerase: Tautomerase enzyme; InterPro: IPR004370 4-Oxalocrotonate tautomerase (4-OT) catalyzes the isomerisation of beta,gamma-unsaturated enones to their alpha,beta-isomers Back     alignment and domain information
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase: Catalyzes the isomerization of unsaturated ketones Back     alignment and domain information
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme Back     alignment and domain information
>PF02962 CHMI: 5-carboxymethyl-2-hydroxymuconate isomerase; InterPro: IPR004220 5-carboxymethyl-2-hydroxymuconate isomerase transforms 5-carboxymethyl-2-hydroxy-muconic acid into 5-oxo-pent-3-ene-1,2,5-tricarboxylic acid during the third step of the homoprotocatechuate catabolic pathway [] Back     alignment and domain information
>PTZ00397 macrophage migration inhibition factor-like protein; Provisional Back     alignment and domain information
>COG3232 HpaF 5-carboxymethyl-2-hydroxymuconate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PF14552 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C Back     alignment and domain information
>PF14832 Tautomerase_3: Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A Back     alignment and domain information
>PTZ00450 macrophage migration inhibitory factor-like protein; Provisional Back     alignment and domain information
>PF01187 MIF: Macrophage migration inhibitory factor (MIF); InterPro: IPR001398 Macrophage migration inhibitory factor (MIF) is a key regulatory cytokine within innate and adaptive immune responses, capable of promoting and modulating the magnitude of the response [] Back     alignment and domain information
>cd00580 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) is a trimeric enzyme catalyzing the isomerization of the unsaturated ketone 5-(carboxymethyl)-2-hydroxymuconate to 5-(carboxymethyl)-2-oxo-3-hexene-1,6-dionate Back     alignment and domain information
>TIGR02544 III_secr_YscJ type III secretion apparatus lipoprotein, YscJ/HrcJ family Back     alignment and domain information
>TIGR02830 spore_III_AG stage III sporulation protein AG Back     alignment and domain information
>KOG1759 consensus Macrophage migration inhibitory factor [Defense mechanisms] Back     alignment and domain information
>PF09581 Spore_III_AF: Stage III sporulation protein AF (Spore_III_AF); InterPro: IPR014245 This family represents the stage III sporulation protein AF (SpoIIIAF) of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives) Back     alignment and domain information
>cd00673 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain Back     alignment and domain information
>PF02594 DUF167: Uncharacterised ACR, YggU family COG1872; InterPro: IPR003746 This entry describes proteins of unknown function Back     alignment and domain information
>PF08921 DUF1904: Domain of unknown function (DUF1904); InterPro: IPR015017 This entry represents a family of hypothetical bacterial proteins Back     alignment and domain information
>PF11090 DUF2833: Protein of unknown function (DUF2833); InterPro: IPR020335 This entry contains proteins with no known function Back     alignment and domain information
>PRK05090 hypothetical protein; Validated Back     alignment and domain information
>PRK15348 type III secretion system lipoprotein SsaJ; Provisional Back     alignment and domain information
>COG3887 Predicted signaling protein consisting of a modified GGDEF domain and a DHH domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK00647 hypothetical protein; Validated Back     alignment and domain information
>PRK01310 hypothetical protein; Validated Back     alignment and domain information
>PRK01530 hypothetical protein; Reviewed Back     alignment and domain information
>COG0245 IspF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Lipid metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
2xcz_A115 Crystal Structure Of Macrophage Migration Inhibitor 1e-16
1hfo_A113 The Structure Of The Macrophage Migration Inhibitor 1e-14
1uiz_A115 Crystal Structure Of Macrophage Migration Inhibitor 9e-14
1mfi_A114 Crystal Structure Of Macrophage Migration Inhibitor 8e-12
1mif_A115 Macrophage Migration Inhibitory Factor (Mif) Length 1e-11
3hof_A123 Structure Of Macrophage Migration Inhibitory Factor 1e-11
1gif_A115 Human Glycosylation-Inhibiting Factor Length = 115 1e-11
1fim_A114 Macrophage Migration Inhibitory Factor Length = 114 2e-11
1mff_A114 Macrophage Migration Inhibitory Factor Y95f Mutant 2e-11
4evg_A114 Crystal Structure Of Mif L46a Mutant Length = 114 3e-11
4etg_A114 Crystal Structure Of Mif L46g Mutant Length = 114 4e-11
1ca7_A114 Macrophage Migration Inhibitory Factor (Mif) With H 5e-11
1gcz_A122 Macrophage Migration Inhibitory Factor (Mif) Comple 5e-11
1cgq_A115 Macrophage Migration Inhibitory Factor (Mif) With A 6e-11
4eui_A114 Crystal Structure Of Mif L46f Mutant Length = 114 7e-11
1p1g_A114 Macrophage Migration Inhibitory Factor (Mif) With P 7e-11
3gac_A117 Structure Of Mif With Hpp Length = 117 9e-10
2wkb_A125 Crystal Structure Of Macrophage Migration Inhibitor 9e-10
3fwt_A133 Crystal Structure Of Leishmania Major Mif2 Length = 1e-08
4dh4_A114 Macrophage Migration Inhibitory Factor Toxoplasma G 1e-08
2wkf_A125 Crystal Structure Of Macrophage Migration Inhibitor 9e-08
2wkf_B125 Crystal Structure Of Macrophage Migration Inhibitor 1e-07
3fwu_A133 Crystal Structure Of Leishmania Major Mif1 Length = 6e-07
2os5_A119 Macrophage Migration Inhibitory Factor From Ancylos 2e-06
3b64_A112 Macrophage Migration Inhibitory Factor (Mif) From L 3e-06
1dpt_A117 D-Dopachrome Tautomerase Length = 117 7e-06
3rf4_A116 Ancylostoma Ceylanicum Mif In Complex With Furosemi 9e-06
3t5s_A135 Structure Of Macrophage Migration Inhibitory Factor 4e-05
3ker_A117 D-Dopachrome Tautomerase (D-Dt) MACROPHAGE MIGRATIO 4e-04
>pdb|2XCZ|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor Homologue From Prochlorococcus Marinus Length = 115 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 1/115 (0%)
Query: 1   MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAY 60
           MP +N+  +VP  A  A+ +L++ +  +A++LGK E YVM  +  GVP+ F+G   P  Y
Sbjct: 1   MPLINIQASVPAVA-DANSLLQELSSKLAELLGKPEKYVMTSLQCGVPMTFSGNTEPTCY 59
Query: 61  GELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF 115
            E+ SIG+L  S   ++S  +   ++  L I + R YI   DV    +G+NGSTF
Sbjct: 60  VEVKSIGALDGSRTQEVSELVCGHIEQNLGIPADRIYIGFEDVPARLWGWNGSTF 114
>pdb|1HFO|A Chain A, The Structure Of The Macrophage Migration Inhibitory Factor From Trichinella Spiralis. Length = 113 Back     alignment and structure
>pdb|1UIZ|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor From Xenopus Laevis. Length = 115 Back     alignment and structure
>pdb|1MFI|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor Complexed With (E)-2-Fluoro-P-Hydroxycinnamate Length = 114 Back     alignment and structure
>pdb|1MIF|A Chain A, Macrophage Migration Inhibitory Factor (Mif) Length = 115 Back     alignment and structure
>pdb|3HOF|A Chain A, Structure Of Macrophage Migration Inhibitory Factor (Mif) With Caffeic Acid At 1.9a Resolution Length = 123 Back     alignment and structure
>pdb|1GIF|A Chain A, Human Glycosylation-Inhibiting Factor Length = 115 Back     alignment and structure
>pdb|1FIM|A Chain A, Macrophage Migration Inhibitory Factor Length = 114 Back     alignment and structure
>pdb|1MFF|A Chain A, Macrophage Migration Inhibitory Factor Y95f Mutant Length = 114 Back     alignment and structure
>pdb|4EVG|A Chain A, Crystal Structure Of Mif L46a Mutant Length = 114 Back     alignment and structure
>pdb|4ETG|A Chain A, Crystal Structure Of Mif L46g Mutant Length = 114 Back     alignment and structure
>pdb|1CA7|A Chain A, Macrophage Migration Inhibitory Factor (Mif) With Hydroxphenylpyruvate Length = 114 Back     alignment and structure
>pdb|1GCZ|A Chain A, Macrophage Migration Inhibitory Factor (Mif) Complexed With Inhibitor. Length = 122 Back     alignment and structure
>pdb|1CGQ|A Chain A, Macrophage Migration Inhibitory Factor (Mif) With Alanine Inserted Between Pro-1 And Met-2 Length = 115 Back     alignment and structure
>pdb|4EUI|A Chain A, Crystal Structure Of Mif L46f Mutant Length = 114 Back     alignment and structure
>pdb|1P1G|A Chain A, Macrophage Migration Inhibitory Factor (Mif) With Pro-1 Mutated To Gly-1 Length = 114 Back     alignment and structure
>pdb|3GAC|A Chain A, Structure Of Mif With Hpp Length = 117 Back     alignment and structure
>pdb|2WKB|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor From Plasmodium Berghei Length = 125 Back     alignment and structure
>pdb|3FWT|A Chain A, Crystal Structure Of Leishmania Major Mif2 Length = 133 Back     alignment and structure
>pdb|4DH4|A Chain A, Macrophage Migration Inhibitory Factor Toxoplasma Gondii Length = 114 Back     alignment and structure
>pdb|2WKF|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor From Plasmodium Falciparum Length = 125 Back     alignment and structure
>pdb|2WKF|B Chain B, Crystal Structure Of Macrophage Migration Inhibitory Factor From Plasmodium Falciparum Length = 125 Back     alignment and structure
>pdb|3FWU|A Chain A, Crystal Structure Of Leishmania Major Mif1 Length = 133 Back     alignment and structure
>pdb|2OS5|A Chain A, Macrophage Migration Inhibitory Factor From Ancylostoma Ceylanicum Length = 119 Back     alignment and structure
>pdb|3B64|A Chain A, Macrophage Migration Inhibitory Factor (Mif) From LEISHMANIA MAJOR Length = 112 Back     alignment and structure
>pdb|1DPT|A Chain A, D-Dopachrome Tautomerase Length = 117 Back     alignment and structure
>pdb|3RF4|A Chain A, Ancylostoma Ceylanicum Mif In Complex With Furosemide Length = 116 Back     alignment and structure
>pdb|3T5S|A Chain A, Structure Of Macrophage Migration Inhibitory Factor From Giardia Lamblia Length = 135 Back     alignment and structure
>pdb|3KER|A Chain A, D-Dopachrome Tautomerase (D-Dt) MACROPHAGE MIGRATION INHIBITORY Factor 2 (Mif2) Complexed With Inhibitor 4-Ipp Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
2wkb_A125 Macrophage migration inhibitory factor; cytokine; 4e-44
3fwt_A133 Macrophage migration inhibitory factor-like protei 1e-42
3t5s_A135 Gilaa.00834.A, macrophage migration inhibitory fac 2e-42
1uiz_A115 MIF, macrophage migration inhibitory factor; cytok 4e-42
3fwu_A133 Macrophage migration inhibitory factor-like protei 7e-42
2xcz_A115 Possible ATLS1-like light-inducible protein; cytok 1e-41
2os5_A119 Acemif; macrophage migration inhibitory factor, cy 2e-41
3b64_A112 Macrophage migration inhibitory factor-like protei 4e-41
3djh_A114 Macrophage migration inhibitory factor; homotrimer 2e-40
1hfo_A113 Migration inhibitory factor; tautomerase; 1.65A {T 3e-40
3kan_A117 D-dopachrome tautomerase; immune response, cytokin 9e-39
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A* Length = 125 Back     alignment and structure
 Score =  138 bits (350), Expect = 4e-44
 Identities = 35/114 (30%), Positives = 54/114 (47%)

Query: 2   PTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYG 61
           P   L TN+ +    A + L +   A++ ILGK  +Y+M   +    + F+G+     + 
Sbjct: 1   PCCELITNISIPDDKAQNTLSEIEDAISNILGKPVAYIMSNYDYQKNLRFSGSNEGYCFV 60

Query: 62  ELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF 115
            L SIG +  S N  L+  I +IL   L +   R YI+  D     F F+GS F
Sbjct: 61  RLTSIGGINRSNNSLLADKITKILSNHLSVKPRRVYIEFRDCSAQNFAFSGSLF 114
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major} Length = 133 Back     alignment and structure
>3t5s_A Gilaa.00834.A, macrophage migration inhibitory factor; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Giardia lamblia} Length = 135 Back     alignment and structure
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3 Length = 115 Back     alignment and structure
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major} Length = 133 Back     alignment and structure
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus} Length = 115 Back     alignment and structure
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode,; 1.60A {Ancylostoma ceylanicum} PDB: 3rf4_A* 3rf5_A* Length = 119 Back     alignment and structure
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major} Length = 112 Back     alignment and structure
>3djh_A Macrophage migration inhibitory factor; homotrimer, cytokine, inflammatory response, isomerase, phosphoprotein; 1.25A {Homo sapiens} PDB: 1ca7_A* 1ljt_A* 2ooh_A* 2ooz_A* 3b9s_A* 2oow_A* 3ce4_A 3dji_A* 3ijg_A* 3ijj_A* 1gd0_A* 1gcz_A* 3jsf_A* 3jsg_A* 3jtu_A* 3l5p_A* 3l5r_A* 3l5s_A* 3l5t_A* 3l5u_A* ... Length = 114 Back     alignment and structure
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3 Length = 113 Back     alignment and structure
>3kan_A D-dopachrome tautomerase; immune response, cytokine, cytokine-inhibitor C; HET: RW1; 1.13A {Homo sapiens} PDB: 1dpt_A* 3ker_A* Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
3djh_A114 Macrophage migration inhibitory factor; homotrimer 100.0
4dh4_A114 MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} 100.0
3t5s_A135 Gilaa.00834.A, macrophage migration inhibitory fac 100.0
3kan_A117 D-dopachrome tautomerase; immune response, cytokin 100.0
3fwu_A133 Macrophage migration inhibitory factor-like protei 100.0
3fwt_A133 Macrophage migration inhibitory factor-like protei 100.0
1uiz_A115 MIF, macrophage migration inhibitory factor; cytok 100.0
2xcz_A115 Possible ATLS1-like light-inducible protein; cytok 100.0
1hfo_A113 Migration inhibitory factor; tautomerase; 1.65A {T 100.0
2os5_A119 Acemif; macrophage migration inhibitory factor, cy 100.0
2wkb_A125 Macrophage migration inhibitory factor; cytokine; 100.0
3b64_A112 Macrophage migration inhibitory factor-like protei 100.0
2aal_A131 Malonate semialdehyde decarboxylase; tautomerase s 100.0
1mww_A128 Hypothetical protein HI1388.1; structural genomics 99.97
3n4h_A148 Putative tautomerase; CG10062, CIS-3-chloroacrylic 99.93
3mlc_A136 FG41 malonate semialdehyde decarboxylase; tautomer 99.9
3c6v_A161 Probable tautomerase/dehalogenase AU4130; aspergil 99.87
1u9d_A122 Hypothetical protein VC0714; structural genomics, 99.78
3mf7_A149 CIS-3-chloroacrylic acid dehalogenase; beta-alpha- 99.75
2opa_A61 Probable tautomerase YWHB; homohexamer, 4-oxalocro 99.7
1otf_A62 4-oxalocrotonate tautomerase; isomerase; 1.90A {Ps 99.69
3abf_A64 4-oxalocrotonate tautomerase; isomerase; 1.94A {Th 99.67
2x4k_A63 4-oxalocrotonate tautomerase; isomerase; 1.10A {St 99.62
3m21_A67 Probable tautomerase HP_0924; 4-oxalocrotonate tau 99.62
3m20_A62 4-oxalocrotonate tautomerase, putative; DMPI, ther 99.61
3ry0_A65 Putative tautomerase; oxalocrotonate tautomerase f 99.58
3mb2_A72 4-oxalocrotonate tautomerase family enzyme - ALPH; 99.58
3ej9_A76 Alpha-subunit of trans-3-chloroacrylic acid dehal; 99.57
3e6q_A146 Putative 5-carboxymethyl-2-hydroxymuconate isomer; 99.45
1otg_A125 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A 99.37
3abf_A64 4-oxalocrotonate tautomerase; isomerase; 1.94A {Th 99.37
3ej9_B70 Beta-subunit of trans-3-chloroacrylic acid dehalo; 99.33
1gyx_A76 YDCE, B1461, hypothetical protein YDCE; tautomeras 99.33
2x4k_A63 4-oxalocrotonate tautomerase; isomerase; 1.10A {St 99.23
3mb2_A72 4-oxalocrotonate tautomerase family enzyme - ALPH; 99.12
3ej9_A76 Alpha-subunit of trans-3-chloroacrylic acid dehal; 98.96
3n4h_A148 Putative tautomerase; CG10062, CIS-3-chloroacrylic 98.81
3m20_A62 4-oxalocrotonate tautomerase, putative; DMPI, ther 98.8
2aal_A131 Malonate semialdehyde decarboxylase; tautomerase s 98.76
3m21_A67 Probable tautomerase HP_0924; 4-oxalocrotonate tau 98.71
3mlc_A136 FG41 malonate semialdehyde decarboxylase; tautomer 98.7
3mb2_B72 4-oxalocrotonate tautomerase family enzyme - beta; 98.68
3c6v_A161 Probable tautomerase/dehalogenase AU4130; aspergil 98.66
3ry0_A65 Putative tautomerase; oxalocrotonate tautomerase f 98.65
2opa_A61 Probable tautomerase YWHB; homohexamer, 4-oxalocro 98.64
1otf_A62 4-oxalocrotonate tautomerase; isomerase; 1.90A {Ps 98.59
3mf7_A149 CIS-3-chloroacrylic acid dehalogenase; beta-alpha- 98.56
1mww_A128 Hypothetical protein HI1388.1; structural genomics 98.53
3ej9_B70 Beta-subunit of trans-3-chloroacrylic acid dehalo; 98.28
2wkb_A125 Macrophage migration inhibitory factor; cytokine; 98.26
2xcz_A115 Possible ATLS1-like light-inducible protein; cytok 98.18
1hfo_A113 Migration inhibitory factor; tautomerase; 1.65A {T 98.15
3b64_A112 Macrophage migration inhibitory factor-like protei 98.15
1gyx_A76 YDCE, B1461, hypothetical protein YDCE; tautomeras 98.13
1uiz_A115 MIF, macrophage migration inhibitory factor; cytok 98.07
2os5_A119 Acemif; macrophage migration inhibitory factor, cy 98.0
1u9d_A122 Hypothetical protein VC0714; structural genomics, 97.94
3fwt_A133 Macrophage migration inhibitory factor-like protei 97.58
3t5s_A135 Gilaa.00834.A, macrophage migration inhibitory fac 97.58
3fwu_A133 Macrophage migration inhibitory factor-like protei 97.54
4dh4_A114 MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} 97.51
3djh_A114 Macrophage migration inhibitory factor; homotrimer 97.31
3mb2_B72 4-oxalocrotonate tautomerase family enzyme - beta; 96.89
3kan_A117 D-dopachrome tautomerase; immune response, cytokin 96.43
1otg_A125 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A 96.33
2y9j_Y170 Lipoprotein PRGK, protein PRGK; protein transport, 90.35
1n91_A108 ORF, hypothetical protein; alpha+beta, northeast s 90.26
3e6q_A146 Putative 5-carboxymethyl-2-hydroxymuconate isomer; 89.7
>3djh_A Macrophage migration inhibitory factor; homotrimer, cytokine, inflammatory response, isomerase, phosphoprotein; 1.25A {Homo sapiens} SCOP: d.80.1.3 PDB: 1ca7_A* 1ljt_A* 2ooh_A* 2ooz_A* 3b9s_A* 2oow_A* 3ce4_A 3dji_A* 3ijg_A* 3ijj_A* 3smb_A* 3smc_A* 3u18_A* 4f2k_A* 1gd0_A* 1gcz_A* 3jsf_A* 3jsg_A* 3jtu_A* 3l5p_A* ... Back     alignment and structure
Probab=100.00  E-value=1.3e-44  Score=226.76  Aligned_cols=113  Identities=33%  Similarity=0.555  Sum_probs=110.9

Q ss_pred             CeEEEEeCCCCCccCHHHHHHHHHHHHHHHhCCCcceeEEEEeCCceEEeccCCCceeEEEEEeecCCChhhhHHHHHHH
Q 033597            2 PTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSSTI   81 (115)
Q Consensus         2 P~i~i~tn~~~~~~~~~~~~~~l~~~~a~~~~kp~~~i~v~~~~~~~~~~gg~~~p~~~v~i~~~~~~~~~~~~~~~~~i   81 (115)
                      |+++|+||++.+++ +++|++++++++|+++|||++++||++++++.|+|||+++||+|++|+++|++++++|++++++|
T Consensus         1 P~i~~~TNv~~~~~-~~~~~~~ls~~~a~~lgKpe~~vmV~~~~~~~m~fgGs~~P~a~~~v~sig~~~~~~n~~~s~~i   79 (114)
T 3djh_A            1 PMFIVNTNVPRASV-PDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLL   79 (114)
T ss_dssp             CEEEEEESSCGGGS-CTTHHHHHHHHHHHHHCCCGGGCEEEEECSCEEEETTBCSSCEEEEEEESSCCSHHHHHHHHHHH
T ss_pred             CEEEEEecCCcccc-cHHHHHHHHHHHHHHHCCCHHHeEEEEeCCceEEEcCcCCCEEEEEEEEccCCCHHHHHHHHHHH
Confidence            99999999998886 68999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhHhCCCCCceEEEEEecCCCCceecCccC
Q 033597           82 AEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF  115 (115)
Q Consensus        82 ~~~l~~~Lgv~~~ri~i~f~~~~~~~~g~~G~t~  115 (115)
                      +++++++||||++|+||.|+|++++||||||+||
T Consensus        80 ~~~l~~~Lgi~~~riyI~f~d~~~~~~g~~G~tf  113 (114)
T 3djh_A           80 CGLLAERLRISPDRVYINYYDMNAANVGWNNSTF  113 (114)
T ss_dssp             HHHHHHHHCCCGGGEEEEEEECCGGGEEETTEEC
T ss_pred             HHHHHHHhCcCcceEEEEEEECCHHHeeECCEEC
Confidence            9999999999999999999999999999999998
>4dh4_A MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} Back     alignment and structure
>3t5s_A Gilaa.00834.A, macrophage migration inhibitory factor; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Giardia lamblia} Back     alignment and structure
>3kan_A D-dopachrome tautomerase; immune response, cytokine, cytokine-inhibitor C; HET: RW1; 1.13A {Homo sapiens} SCOP: d.80.1.3 PDB: 1dpt_A* 3ker_A* Back     alignment and structure
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major} Back     alignment and structure
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major} Back     alignment and structure
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3 Back     alignment and structure
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus} Back     alignment and structure
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3 Back     alignment and structure
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode,; 1.60A {Ancylostoma ceylanicum} PDB: 3rf4_A* 3rf5_A* Back     alignment and structure
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A* Back     alignment and structure
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major} Back     alignment and structure
>2aal_A Malonate semialdehyde decarboxylase; tautomerase superfamily, beta-alpha-beta, homotrimeric, LYAS; 1.65A {Pseudomonas pavonaceae} SCOP: d.80.1.6 PDB: 2aag_A 2aaj_A Back     alignment and structure
>1mww_A Hypothetical protein HI1388.1; structural genomics, structure 2 function project, S2F, unknown function; HET: GLU; 2.08A {Haemophilus influenzae} SCOP: d.80.1.4 Back     alignment and structure
>3n4h_A Putative tautomerase; CG10062, CIS-3-chloroacrylic acid dehalogenase, tautomerase superfamily, beta-alpha-beta motif, hydrolase; HET: PR7; 2.02A {Corynebacterium glutamicum} PDB: 3n4d_A* 3n4g_A Back     alignment and structure
>3mlc_A FG41 malonate semialdehyde decarboxylase; tautomerase superfamily, malonate semialdehyde decarboxylase alpha-beta-motif; 2.22A {Coryneform bacterium} SCOP: d.80.1.0 PDB: 3mjz_A Back     alignment and structure
>3c6v_A Probable tautomerase/dehalogenase AU4130; aspergillus fumigatus trimeric thermophilic probable tautomerase/dehalogenase; HET: MSE; 1.90A {Aspergillus fumigatus AF293} Back     alignment and structure
>1u9d_A Hypothetical protein VC0714; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics; 1.70A {Vibrio cholerae o1 biovar eltor str} SCOP: d.80.1.5 Back     alignment and structure
>3mf7_A CIS-3-chloroacrylic acid dehalogenase; beta-alpha-beta motif, tautomerase, CIS-3-CHLO acid dehalogenase, isomerase, hydrolase; HET: PR4; 1.65A {Coryneform bacterium} PDB: 3mf8_A 2flt_A 2flz_A Back     alignment and structure
>2opa_A Probable tautomerase YWHB; homohexamer, 4-oxalocrotonate tautomerase, inhibitor, 2-FLUO hydroxycinnamate, isomerase; HET: FHC; 2.40A {Bacillus subtilis} PDB: 2op8_A* Back     alignment and structure
>1otf_A 4-oxalocrotonate tautomerase; isomerase; 1.90A {Pseudomonas SP} SCOP: d.80.1.1 PDB: 4otc_A 4ota_A 4otb_A 1bjp_A 2fm7_A Back     alignment and structure
>3abf_A 4-oxalocrotonate tautomerase; isomerase; 1.94A {Thermus thermophilus} Back     alignment and structure
>2x4k_A 4-oxalocrotonate tautomerase; isomerase; 1.10A {Staphylococcus aureus} Back     alignment and structure
>3m21_A Probable tautomerase HP_0924; 4-oxalocrotonate tautomerase, catalytic proline, hexamer, BE beta, isomerase; 1.90A {Helicobacter pylori} PDB: 2orm_A Back     alignment and structure
>3m20_A 4-oxalocrotonate tautomerase, putative; DMPI, thermophIle, beta-alpha-beta, catalytic proline, isomerase; 2.37A {Archaeoglobus fulgidus} Back     alignment and structure
>3ry0_A Putative tautomerase; oxalocrotonate tautomerase family, isomerase; 1.40A {Streptomyces achromogenes} Back     alignment and structure
>3mb2_A 4-oxalocrotonate tautomerase family enzyme - ALPH; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3ej9_A Alpha-subunit of trans-3-chloroacrylic acid dehal; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej3_A 1s0y_A 3ej7_A Back     alignment and structure
>3e6q_A Putative 5-carboxymethyl-2-hydroxymuconate isomer; structural genomics, APC7683, isomerase, PSI-2, protein STRU initiative; HET: GOL IMD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1otg_A 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A {Escherichia coli} SCOP: d.80.1.2 Back     alignment and structure
>3abf_A 4-oxalocrotonate tautomerase; isomerase; 1.94A {Thermus thermophilus} Back     alignment and structure
>3ej9_B Beta-subunit of trans-3-chloroacrylic acid dehalo; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej7_B 3ej3_B 1s0y_B Back     alignment and structure
>1gyx_A YDCE, B1461, hypothetical protein YDCE; tautomerase, isomerase, complete proteo; HET: EPE; 1.35A {Escherichia coli} SCOP: d.80.1.1 PDB: 1gyj_A* 1gyy_A* Back     alignment and structure
>2x4k_A 4-oxalocrotonate tautomerase; isomerase; 1.10A {Staphylococcus aureus} Back     alignment and structure
>3mb2_A 4-oxalocrotonate tautomerase family enzyme - ALPH; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3ej9_A Alpha-subunit of trans-3-chloroacrylic acid dehal; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej3_A 1s0y_A 3ej7_A Back     alignment and structure
>3n4h_A Putative tautomerase; CG10062, CIS-3-chloroacrylic acid dehalogenase, tautomerase superfamily, beta-alpha-beta motif, hydrolase; HET: PR7; 2.02A {Corynebacterium glutamicum} PDB: 3n4d_A* 3n4g_A Back     alignment and structure
>3m20_A 4-oxalocrotonate tautomerase, putative; DMPI, thermophIle, beta-alpha-beta, catalytic proline, isomerase; 2.37A {Archaeoglobus fulgidus} Back     alignment and structure
>2aal_A Malonate semialdehyde decarboxylase; tautomerase superfamily, beta-alpha-beta, homotrimeric, LYAS; 1.65A {Pseudomonas pavonaceae} SCOP: d.80.1.6 PDB: 2aag_A 2aaj_A Back     alignment and structure
>3m21_A Probable tautomerase HP_0924; 4-oxalocrotonate tautomerase, catalytic proline, hexamer, BE beta, isomerase; 1.90A {Helicobacter pylori} PDB: 2orm_A Back     alignment and structure
>3mlc_A FG41 malonate semialdehyde decarboxylase; tautomerase superfamily, malonate semialdehyde decarboxylase alpha-beta-motif; 2.22A {Coryneform bacterium} SCOP: d.80.1.0 PDB: 3mjz_A Back     alignment and structure
>3mb2_B 4-oxalocrotonate tautomerase family enzyme - beta; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3c6v_A Probable tautomerase/dehalogenase AU4130; aspergillus fumigatus trimeric thermophilic probable tautomerase/dehalogenase; HET: MSE; 1.90A {Aspergillus fumigatus AF293} Back     alignment and structure
>3ry0_A Putative tautomerase; oxalocrotonate tautomerase family, isomerase; 1.40A {Streptomyces achromogenes} Back     alignment and structure
>2opa_A Probable tautomerase YWHB; homohexamer, 4-oxalocrotonate tautomerase, inhibitor, 2-FLUO hydroxycinnamate, isomerase; HET: FHC; 2.40A {Bacillus subtilis} PDB: 2op8_A* Back     alignment and structure
>1otf_A 4-oxalocrotonate tautomerase; isomerase; 1.90A {Pseudomonas SP} SCOP: d.80.1.1 PDB: 4otc_A 4ota_A 4otb_A 1bjp_A 2fm7_A Back     alignment and structure
>3mf7_A CIS-3-chloroacrylic acid dehalogenase; beta-alpha-beta motif, tautomerase, CIS-3-CHLO acid dehalogenase, isomerase, hydrolase; HET: PR4; 1.65A {Coryneform bacterium} PDB: 3mf8_A 2flt_A 2flz_A Back     alignment and structure
>1mww_A Hypothetical protein HI1388.1; structural genomics, structure 2 function project, S2F, unknown function; HET: GLU; 2.08A {Haemophilus influenzae} SCOP: d.80.1.4 Back     alignment and structure
>3ej9_B Beta-subunit of trans-3-chloroacrylic acid dehalo; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej7_B 3ej3_B 1s0y_B Back     alignment and structure
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A* Back     alignment and structure
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus} Back     alignment and structure
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3 Back     alignment and structure
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major} Back     alignment and structure
>1gyx_A YDCE, B1461, hypothetical protein YDCE; tautomerase, isomerase, complete proteo; HET: EPE; 1.35A {Escherichia coli} SCOP: d.80.1.1 PDB: 1gyj_A* 1gyy_A* Back     alignment and structure
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3 Back     alignment and structure
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode,; 1.60A {Ancylostoma ceylanicum} PDB: 3rf4_A* 3rf5_A* Back     alignment and structure
>1u9d_A Hypothetical protein VC0714; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics; 1.70A {Vibrio cholerae o1 biovar eltor str} SCOP: d.80.1.5 Back     alignment and structure
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major} Back     alignment and structure
>3t5s_A Gilaa.00834.A, macrophage migration inhibitory factor; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Giardia lamblia} Back     alignment and structure
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major} Back     alignment and structure
>4dh4_A MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} Back     alignment and structure
>3djh_A Macrophage migration inhibitory factor; homotrimer, cytokine, inflammatory response, isomerase, phosphoprotein; 1.25A {Homo sapiens} SCOP: d.80.1.3 PDB: 1ca7_A* 1ljt_A* 2ooh_A* 2ooz_A* 3b9s_A* 2oow_A* 3ce4_A 3dji_A* 3ijg_A* 3ijj_A* 3smb_A* 3smc_A* 3u18_A* 4f2k_A* 1gd0_A* 1gcz_A* 3jsf_A* 3jsg_A* 3jtu_A* 3l5p_A* ... Back     alignment and structure
>3mb2_B 4-oxalocrotonate tautomerase family enzyme - beta; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3kan_A D-dopachrome tautomerase; immune response, cytokine, cytokine-inhibitor C; HET: RW1; 1.13A {Homo sapiens} SCOP: d.80.1.3 PDB: 1dpt_A* 3ker_A* Back     alignment and structure
>1otg_A 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A {Escherichia coli} SCOP: d.80.1.2 Back     alignment and structure
>2y9j_Y Lipoprotein PRGK, protein PRGK; protein transport, type III secretion, IR1, inner membrane R C24-fold; 6.40A {Salmonella enterica subsp} Back     alignment and structure
>1n91_A ORF, hypothetical protein; alpha+beta, northeast structural genomics consortium, PSI, P structure initiative, NESG; NMR {Escherichia coli} SCOP: d.206.1.1 PDB: 1yh5_A Back     alignment and structure
>3e6q_A Putative 5-carboxymethyl-2-hydroxymuconate isomer; structural genomics, APC7683, isomerase, PSI-2, protein STRU initiative; HET: GOL IMD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 115
d1uiza_115 d.80.1.3 (A:) Microphage migration inhibition fact 1e-41
d1hfoa_113 d.80.1.3 (A:) Microphage migration inhibition fact 3e-40
d2gdga1114 d.80.1.3 (A:1-114) Microphage migration inhibition 3e-39
d1dpta_117 d.80.1.3 (A:) D-dopachrome tautomerase {Human (Hom 1e-36
d1mwwa_120 d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemo 5e-11
>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 115 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Tautomerase/MIF
superfamily: Tautomerase/MIF
family: MIF-related
domain: Microphage migration inhibition factor (MIF)
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score =  131 bits (330), Expect = 1e-41
 Identities = 42/115 (36%), Positives = 60/115 (52%), Gaps = 1/115 (0%)

Query: 1   MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAY 60
           MP   + TNV  D+V    +L D TK +AK  GK   Y+ I I     ++F  +  P A 
Sbjct: 1   MPVFTIRTNVCRDSV-PDTLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAV 59

Query: 61  GELISIGSLGPSVNGKLSSTIAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF 115
             L SIG +G   N   +  + +IL  +L I ++R YI  YD+  +  G+NGSTF
Sbjct: 60  CSLCSIGKIGGPQNKSYTKLLCDILTKQLNIPANRVYINYYDLNAANVGWNGSTF 114
>d1hfoa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]} Length = 113 Back     information, alignment and structure
>d2gdga1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1dpta_ d.80.1.3 (A:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]} Length = 120 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d1uiza_115 Microphage migration inhibition factor (MIF) {Afri 100.0
d1hfoa_113 Microphage migration inhibition factor (MIF) {Tric 100.0
d2gdga1114 Microphage migration inhibition factor (MIF) {Mous 100.0
d1dpta_117 D-dopachrome tautomerase {Human (Homo sapiens) [Ta 100.0
d1mwwa_120 Hypothetical protein HI1388.1 {Haemophilus influen 99.94
d2aala1129 Malonate semialdehyde decarboxylase, MSAD {Pseudom 99.9
d1otfa_59 4-oxalocrotonate tautomerase {Pseudomonas sp., Dmp 99.6
d1s0ya_62 Trans-3-chloroacrylic acid dehalogenase alpha-subu 99.54
d1gyxa_76 4-oxalocrotonate tautomerase homologue YdcE {Esche 99.13
d1u9da_122 Hypothetical protein VC0714 {Vibrio cholerae [TaxI 98.93
d1otfa_59 4-oxalocrotonate tautomerase {Pseudomonas sp., Dmp 98.71
d1s0ya_62 Trans-3-chloroacrylic acid dehalogenase alpha-subu 98.64
d2aala1129 Malonate semialdehyde decarboxylase, MSAD {Pseudom 98.56
d1gyxa_76 4-oxalocrotonate tautomerase homologue YdcE {Esche 98.3
d1otga_125 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) 98.16
d1mwwa_120 Hypothetical protein HI1388.1 {Haemophilus influen 97.99
d1s0yb_55 Trans-3-chloroacrylic acid dehalogenase beta-subun 97.27
d2gdga1114 Microphage migration inhibition factor (MIF) {Mous 96.77
d1hfoa_113 Microphage migration inhibition factor (MIF) {Tric 96.68
d1uiza_115 Microphage migration inhibition factor (MIF) {Afri 96.6
d1dpta_117 D-dopachrome tautomerase {Human (Homo sapiens) [Ta 95.61
d1s0yb_55 Trans-3-chloroacrylic acid dehalogenase beta-subun 94.95
d1u9da_122 Hypothetical protein VC0714 {Vibrio cholerae [TaxI 89.0
d1jwqa_179 N-acetylmuramoyl-L-alanine amidase CwlV {Paenibaci 84.47
d1riqa2236 Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [ 81.56
d1yh5a1100 Hypothetical protein YggU {Escherichia coli, o157 80.22
>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Tautomerase/MIF
superfamily: Tautomerase/MIF
family: MIF-related
domain: Microphage migration inhibition factor (MIF)
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=100.00  E-value=2e-47  Score=238.27  Aligned_cols=114  Identities=37%  Similarity=0.584  Sum_probs=111.6

Q ss_pred             CCeEEEEeCCCCCccCHHHHHHHHHHHHHHHhCCCcceeEEEEeCCceEEeccCCCceeEEEEEeecCCChhhhHHHHHH
Q 033597            1 MPTLNLYTNVPVDAVIASDILRDATKAVAKILGKSESYVMILINGGVPIAFAGTEAPAAYGELISIGSLGPSVNGKLSST   80 (115)
Q Consensus         1 MP~i~i~tn~~~~~~~~~~~~~~l~~~~a~~~~kp~~~i~v~~~~~~~~~~gg~~~p~~~v~i~~~~~~~~~~~~~~~~~   80 (115)
                      ||+++|+||++.+++ +++|++++++++|+++|||+++|||+++++++|+|||+++||+|++++++|++++++|++++++
T Consensus         1 MP~i~i~TNv~~~~~-~~~~~~~ls~~ia~~lgKpe~~vmv~v~~~~~m~fggs~~P~a~~~v~siG~l~~~~n~~~s~~   79 (115)
T d1uiza_           1 MPVFTIRTNVCRDSV-PDTLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAVCSLCSIGKIGGPQNKSYTKL   79 (115)
T ss_dssp             CCEEEEEESSCGGGS-CTTHHHHHHHHHHHHHTCCGGGCEEEEECSCEEEETTBCSSCEEEEEEESSCCSHHHHHHHHHH
T ss_pred             CCeEEEEecCCchhC-hHHHHHHHHHHHHHHHCCCHHHEEEEEcCCceEEeCCCCCcEEEEEEEEEcCCChhhhHHHHHH
Confidence            999999999988765 7899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhHhCCCCCceEEEEEecCCCCceecCccC
Q 033597           81 IAEILQTKLLIDSSRFYIKLYDVERSFFGFNGSTF  115 (115)
Q Consensus        81 i~~~l~~~Lgv~~~ri~i~f~~~~~~~~g~~G~t~  115 (115)
                      |+++++++||||++|+||.|+|+++++|||||+||
T Consensus        80 i~~~l~~~LgI~~~Riyi~f~d~~~~~~G~nG~TF  114 (115)
T d1uiza_          80 LCDILTKQLNIPANRVYINYYDLNAANVGWNGSTF  114 (115)
T ss_dssp             HHHHHHHHHCCCGGGEEEEEEECCGGGEEETTEEC
T ss_pred             HHHHHHHHcCCCcceEEEEEEECCHHHeeECcEEC
Confidence            99999999999999999999999999999999998
>d1hfoa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]} Back     information, alignment and structure
>d2gdga1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dpta_ d.80.1.3 (A:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2aala1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1otfa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase {Pseudomonas sp., DmpI [TaxId: 306]} Back     information, alignment and structure
>d1s0ya_ d.80.1.1 (A:) Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1gyxa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase homologue YdcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u9da_ d.80.1.5 (A:) Hypothetical protein VC0714 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1otfa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase {Pseudomonas sp., DmpI [TaxId: 306]} Back     information, alignment and structure
>d1s0ya_ d.80.1.1 (A:) Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d2aala1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1gyxa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase homologue YdcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1otga_ d.80.1.2 (A:) 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s0yb_ d.80.1.1 (B:) Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d2gdga1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hfoa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]} Back     information, alignment and structure
>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1dpta_ d.80.1.3 (A:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s0yb_ d.80.1.1 (B:) Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1u9da_ d.80.1.5 (A:) Hypothetical protein VC0714 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1jwqa_ c.56.5.6 (A:) N-acetylmuramoyl-L-alanine amidase CwlV {Paenibacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1riqa2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yh5a1 d.206.1.1 (A:1-100) Hypothetical protein YggU {Escherichia coli, o157 [TaxId: 562]} Back     information, alignment and structure