Citrus Sinensis ID: 033609
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| 351725577 | 100 | uncharacterized protein LOC100527831 [Gl | 0.852 | 0.98 | 0.792 | 8e-40 | |
| 449483597 | 100 | PREDICTED: uncharacterized LOC101206121 | 0.773 | 0.89 | 0.842 | 2e-39 | |
| 225439584 | 100 | PREDICTED: uncharacterized protein LOC10 | 0.773 | 0.89 | 0.831 | 6e-39 | |
| 356506766 | 100 | PREDICTED: uncharacterized protein LOC10 | 0.852 | 0.98 | 0.782 | 1e-38 | |
| 357506359 | 100 | hypothetical protein MTR_7g071210 [Medic | 0.773 | 0.89 | 0.764 | 1e-35 | |
| 28393833 | 157 | unknown protein [Arabidopsis thaliana] g | 0.947 | 0.694 | 0.610 | 1e-33 | |
| 30680897 | 163 | uncharacterized protein [Arabidopsis tha | 0.947 | 0.668 | 0.610 | 2e-33 | |
| 388502396 | 101 | unknown [Lotus japonicus] | 0.669 | 0.762 | 0.844 | 2e-33 | |
| 255559591 | 159 | conserved hypothetical protein [Ricinus | 0.782 | 0.566 | 0.711 | 5e-33 | |
| 356567959 | 159 | PREDICTED: uncharacterized protein LOC10 | 0.791 | 0.572 | 0.703 | 4e-32 |
| >gi|351725577|ref|NP_001238121.1| uncharacterized protein LOC100527831 [Glycine max] gi|255633328|gb|ACU17021.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 167 bits (423), Expect = 8e-40, Method: Compositional matrix adjust.
Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 3/101 (2%)
Query: 15 SSVSGNSSSETTRVPLSEVVSDCVKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDA 74
SSV G S RV LSEVV+DCVKRWFRD LKEAK GDINMQVLVGQMY+ GYGV RDA
Sbjct: 3 SSVGGERSE---RVALSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYYGGYGVPRDA 59
Query: 75 QKGRIWISRASRTRSSVWKVGEKHPGYNASDSDSDEMKEES 115
QKGR+W+++ASRTRSSVWKVG+KHPGYNASDSDSDE+KE+S
Sbjct: 60 QKGRVWLTKASRTRSSVWKVGDKHPGYNASDSDSDELKEDS 100
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449483597|ref|XP_004156634.1| PREDICTED: uncharacterized LOC101206121 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225439584|ref|XP_002265642.1| PREDICTED: uncharacterized protein LOC100243041 isoform 1 [Vitis vinifera] gi|359481191|ref|XP_003632590.1| PREDICTED: uncharacterized protein LOC100243041 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356506766|ref|XP_003522147.1| PREDICTED: uncharacterized protein LOC100794599 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357506359|ref|XP_003623468.1| hypothetical protein MTR_7g071210 [Medicago truncatula] gi|355498483|gb|AES79686.1| hypothetical protein MTR_7g071210 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|28393833|gb|AAO42324.1| unknown protein [Arabidopsis thaliana] gi|110737142|dbj|BAF00521.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|30680897|ref|NP_196155.2| uncharacterized protein [Arabidopsis thaliana] gi|332003481|gb|AED90864.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|388502396|gb|AFK39264.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|255559591|ref|XP_002520815.1| conserved hypothetical protein [Ricinus communis] gi|223539946|gb|EEF41524.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356567959|ref|XP_003552182.1| PREDICTED: uncharacterized protein LOC100779520 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| TAIR|locus:2057227 | 138 | AT2G38450 [Arabidopsis thalian | 0.695 | 0.579 | 0.743 | 1.3e-29 | |
| TAIR|locus:2153559 | 163 | AT5G05360 [Arabidopsis thalian | 0.756 | 0.533 | 0.643 | 1.2e-28 |
| TAIR|locus:2057227 AT2G38450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 328 (120.5 bits), Expect = 1.3e-29, P = 1.3e-29
Identities = 61/82 (74%), Positives = 72/82 (87%)
Query: 24 ETTR--VPLSEVVSDCVKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGRIWI 81
ETTR VPLS VVSDC KRWF+DTL+EAK G+I MQVL+GQMY+SGYGV +DA+KGR+WI
Sbjct: 49 ETTRRFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDARKGRLWI 108
Query: 82 SRASRTRSSVWKVGEKHPGYNA 103
++ASR RSSVWKV +K PGYNA
Sbjct: 109 TKASRVRSSVWKVIDKRPGYNA 130
|
|
| TAIR|locus:2153559 AT5G05360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| COG0790 | 292 | COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily | 2e-04 | |
| COG0790 | 292 | COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily | 5e-04 | |
| smart00671 | 36 | smart00671, SEL1, Sel1-like repeats | 7e-04 |
| >gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
Score = 38.9 bits (90), Expect = 2e-04
Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
Query: 40 RWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGRIWISRASR 86
+R K A+ G+ + Q+L+G+MY G GV RD +K W +A+
Sbjct: 176 YLYR---KAAELGNPDAQLLLGRMYEKGLGVPRDLKKAFRWYKKAAE 219
|
Length = 292 |
| >gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214772 smart00671, SEL1, Sel1-like repeats | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| smart00671 | 36 | SEL1 Sel1-like repeats. These represent a subfamil | 99.13 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 99.08 | |
| PF08238 | 39 | Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r | 99.07 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 99.05 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 98.83 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 98.52 | |
| KOG4014 | 248 | consensus Uncharacterized conserved protein (conta | 97.39 | |
| KOG4014 | 248 | consensus Uncharacterized conserved protein (conta | 96.54 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 94.03 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 93.9 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 92.65 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 90.07 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 89.94 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 89.15 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 88.18 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 87.59 | |
| PF08238 | 39 | Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r | 87.38 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 87.15 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 87.04 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 86.26 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 82.74 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 82.06 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 80.49 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 80.35 |
| >smart00671 SEL1 Sel1-like repeats | Back alignment and domain information |
|---|
Probab=99.13 E-value=1e-10 Score=64.93 Aligned_cols=36 Identities=31% Similarity=0.436 Sum_probs=34.1
Q ss_pred HHHHHHHHHHHHcCCCCcCCHHHHHHHHHHHHhcCC
Q 033609 54 INMQVLVGQMYFSGYGVARDAQKGRIWISRASRTRS 89 (115)
Q Consensus 54 ~~Aq~~LG~mY~~G~Gv~kD~~kA~~Wl~kAA~~G~ 89 (115)
+.||+.||.||..|.|+++|..+|+.||++||++|+
T Consensus 1 ~~a~~~lg~~~~~G~g~~~d~~~A~~~~~~Aa~~g~ 36 (36)
T smart00671 1 AEAQYNLGQMYEYGLGVKKDLEKALEYYKKAAELGN 36 (36)
T ss_pred CHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHHHccC
Confidence 368999999999999999999999999999999986
|
These represent a subfamily of TPR (tetratricopeptide repeat) sequences. |
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] | Back alignment and domain information |
|---|
| >KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 7e-07 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 9e-07 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 2e-06 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 4e-06 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 4e-06 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 4e-06 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 5e-06 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 2e-05 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 2e-05 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 1e-06 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 2e-06 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 3e-06 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 6e-06 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 2e-05 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 3e-05 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 1e-06 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 5e-06 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 7e-05 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 2e-04 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 7e-06 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 3e-05 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 2e-05 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 4e-04 |
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
Score = 45.3 bits (108), Expect = 7e-07
Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 3/45 (6%)
Query: 40 RWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGRIWISRA 84
WFR + A+ G + ++G Y +G GV +D + IW +A
Sbjct: 64 DWFR---RAAEQGYTPAEYVLGLRYMNGEGVPQDYAQAVIWYKKA 105
|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 99.43 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 99.38 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.02 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 99.02 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.01 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.97 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.81 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.77 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.57 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.42 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 94.6 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 93.86 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 93.49 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 93.19 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 92.47 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 92.23 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 92.2 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 92.04 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 92.02 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 91.62 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 91.22 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 91.2 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 91.18 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 91.14 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 91.12 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 90.92 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 90.82 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 90.68 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 90.42 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 90.35 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 90.08 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 90.05 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 89.96 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 89.93 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 89.89 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 89.85 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 89.69 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 89.65 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 89.45 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 89.41 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 89.33 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 89.29 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 89.16 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 89.14 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 88.92 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 88.87 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 88.8 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 88.63 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 88.54 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 88.37 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 88.27 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 87.93 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 87.91 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 87.89 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 87.89 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 87.78 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 87.74 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 87.59 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 86.81 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 86.79 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 86.79 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 86.77 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 86.69 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 86.22 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 85.92 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 85.72 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 85.58 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 85.5 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 85.47 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 85.29 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 84.77 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 84.73 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 84.09 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 83.51 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 83.19 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 83.06 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 82.97 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 82.27 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 82.22 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 81.99 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 81.77 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 81.56 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 81.44 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 81.2 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 80.78 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 80.78 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 80.67 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 80.54 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 80.24 |
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
Probab=99.43 E-value=3.6e-13 Score=93.04 Aligned_cols=57 Identities=18% Similarity=0.131 Sum_probs=30.8
Q ss_pred HHHHHHHHHHHHHCCCHHHHHHHHHHHHcCCCCcCCHHHHHHHHHHHHhcCCchhhhccc
Q 033609 38 VKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGRIWISRASRTRSSVWKVGEK 97 (115)
Q Consensus 38 A~~wf~~~~kAA~~Gd~~Aq~~LG~mY~~G~Gv~kD~~kA~~Wl~kAA~~G~~~~~~~~~ 97 (115)
|+.||+ ++++.|++.|+++||.+|..|.||++|+.+|+.||++|+++|++.+.++++
T Consensus 44 A~~~~~---~Aa~~g~~~a~~~Lg~~y~~G~g~~~d~~~A~~~~~~Aa~~g~~~a~~~Lg 100 (138)
T 1klx_A 44 LFQYLS---KACELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSKACGLNDQDGCLILG 100 (138)
T ss_dssp HHHHHH---HHHHTTCHHHHHHHHHHHHHCSSSCCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred HHHHHH---HHHcCCCHHHHHHHHHHHHcCCCCCccHHHHHHHHHHHHcCCCHHHHHHHH
Confidence 555555 555555555555555555555555555555555555555555555444433
|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 115 | ||||
| d1ouva_ | 265 | a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He | 0.002 |
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: HCP-like family: HCP-like domain: Cysteine rich protein C (HcpC) species: Helicobacter pylori [TaxId: 210]
Score = 34.1 bits (76), Expect = 0.002
Identities = 6/34 (17%), Positives = 15/34 (44%)
Query: 53 DINMQVLVGQMYFSGYGVARDAQKGRIWISRASR 86
+ +G M ++G GV R+ ++ + +
Sbjct: 213 NGGGCFNLGAMQYNGEGVTRNEKQAIENFKKGCK 246
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 99.4 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 99.34 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 99.28 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 99.05 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 94.78 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 93.96 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 92.77 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 92.01 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 90.09 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 89.53 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 89.12 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 88.38 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 88.16 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 87.55 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 87.49 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 87.31 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 87.06 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 86.9 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 85.89 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 85.17 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 84.44 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 84.0 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 83.43 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 83.25 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 81.64 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 81.63 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 81.49 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 81.21 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 80.81 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 80.32 |
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: HCP-like family: HCP-like domain: Cysteine rich protein B (HcpB) species: Helicobacter pylori [TaxId: 210]
Probab=99.40 E-value=3.2e-13 Score=91.51 Aligned_cols=59 Identities=17% Similarity=0.116 Sum_probs=35.1
Q ss_pred HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHcCCCCcCCHHHHHHHHHHHHhcCCchhhhccc
Q 033609 36 DCVKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGRIWISRASRTRSSVWKVGEK 97 (115)
Q Consensus 36 ~~A~~wf~~~~kAA~~Gd~~Aq~~LG~mY~~G~Gv~kD~~kA~~Wl~kAA~~G~~~~~~~~~ 97 (115)
+.|+.||+ +++++|++.|++.||.||..|.+|++|+.+|+.||++|+++|++.+.+.++
T Consensus 40 ~~a~~~~~---~aa~~g~~~a~~~Lg~~y~~g~~~~~d~~~A~~~~~~aa~~g~~~a~~~Lg 98 (133)
T d1klxa_ 40 QKLFQYLS---KACELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSKACGLNDQDGCLILG 98 (133)
T ss_dssp HHHHHHHH---HHHHTTCHHHHHHHHHHHHHCSSSCCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred HHHHHHHh---hhhcccchhhhhhHHHhhhhccccchhhHHHHHHHhhhhccCcchHHHHHH
Confidence 44555666 666666666666666666666666666666666666666666655554444
|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|