Citrus Sinensis ID: 033611

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MVSGLINANPVVYEKKERRARSASSCVNDEYAAEQIDQQEVFDHVRDIKDPEHPYSLEELKVITEDAIEVDDERSYVRVTFTPTVEHCSMATVIGLCLRVKLMRSLPPRFKVRRV
ccccccccccEEECcccccccccccccccccHcccccHHHHHHHHcccccccccccHHHHcccccccEEEcccccEEEEEEEEcccccccHHHHHHHHHHHHHHHcccccEEEEc
*VSGLINANPVVYE****************YAAEQIDQQEVFDHVRDIKDPEHPYSLEELKVITEDAIEVDDERSYVRVTFTPTVEHCSMATVIGLCLRVKLMRSLPPRFKVRRV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSGLINANPVVYEKKERRARSASSCVNDEYAAEQIDQQEVFDHVRDIKDPEHPYSLEELKVITEDAIEVDDERSYVRVTFTPTVEHCSMATVIGLCLRVKLMRSLPPRFKVRRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MIP18 family protein At1g68310 May play a role in chromosome segregation through establishment of sister chromatid cohesion.probableQ9C9G6
MIP18 family protein F45G2.10 May play a role in chromosome segregation through establishment of sister chromatid cohesion.probableO62252
Mitotic spindle-associated MMXD complex subunit MIP18 As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation.probableQ9Y3D0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UX2, chain A
Confidence level:very confident
Coverage over the Query: 37-114
View the alignment between query and template
View the model in PyMOL