Citrus Sinensis ID: 033650

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----

MVVPPPRRPLKTYQPSEPYVLKMHLTNKYVSAQVVHSPTATVASSASSQEKALRSTIGCTRDVAAASKIGKLLGERLLLKDIPAVSVFLKREQRYHGKVKAIIDSLREAGVKLL

cccccccccccccccccccEEEEEcccccEEEEEEEccccEEEEEEcccHHHHHHHccccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccccc

****P*R********SEPYVLKMHLTNKYVSAQVVHSPTATVASSASSQEK*****IGCTRDVAAASKIGKLLGERLLLKDIPAVSVFLKREQRYHGKVKAIIDSLREAGVKLL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVVPPPRRPLKTYQPSEPYVLKMHLTNKYVSAQVVHSPTATVASSASSQEKALRSTIGCTRDVAAASKIGKLLGERLLLKDIPAVSVFLKREQRYHGKVKAIIDSLREAGVKLL

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L18	This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance.	probable	B8D9T1
50S ribosomal protein L18	This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance.	probable	Q11HR8
50S ribosomal protein L18	This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance.	probable	Q1MIC5

No EC number assigned to the protein, probably not an enzyme!

Template: 1OVY, chain A
Confidence level:very confident
Coverage over the Query: 14-113
View the alignment between query and template
View the model in PyMOL