Citrus Sinensis ID: 033658


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MEGDIFSGIGNGTQVDGKVLQTFRKSFGQVQDILDQNRLLINEINQNHESKVPDNLTRNVGLIKELNNNIRRVVSLYADLSSSFARSVESSSEGESAAALRSDGKASQKRIRSG
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccccccccccccc
*************QVDGKVLQTFRKSFGQVQDILDQNRLLINEINQNH**KVPDNLTRNVGLIKELNNNIRRVVSLYADLSS********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGDIFSGIGNGTQVDGKVLQTFRKSFGQVQDILDQNRLLINEINQNHESKVPDNLTRNVGLIKELNNNIRRVVSLYADLSSSFARSVESSSEGESAAALRSDGKASQKRIRSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein ELF4-LIKE 4 Component of the central CCA1/LHY-TOC1 feedback loop in the circadian clock that promotes clock accuracy and is required for sustained rhythms in the absence of daily light/dark cycles.confidentQ570U6
Protein ELF4-LIKE 2 Component of the central CCA1/LHY-TOC1 feedback loop in the circadian clock that promotes clock accuracy and is required for sustained rhythms in the absence of daily light/dark cycles.probableQ94BS8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted