Citrus Sinensis ID: 033711

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MSDFDIQVPAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF
cccccccccccccccccccccccccccccEEEEEEEECcccEEEEEEEcccccccHHHHHHHHHccECcccCEEEcccccEEEEEEccHHcHHHHHHHHHcccccccEEEccc
**DFDIQVPAAFDPFADAK**********YVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDFDIQVPAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein translation factor SUI1 homolog 1 Probably involved in translation.confidentP41568
Protein translation factor SUI1 homolog Probably involved in translation.confidentQ0D5W6
Protein translation factor SUI1 homolog 2 Probably involved in translation.confidentQ94JV4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IF1, chain A
Confidence level:very confident
Coverage over the Query: 1-113
View the alignment between query and template
View the model in PyMOL