Citrus Sinensis ID: 033740

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MTFKRRNGGRNKHGRGHVNFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQDACIYDNYVLPKLYAKMQYCVSCAIHSHVVRVRSRTDRRNREPPKRFMRRRVSFACFY
cccccccccccccccccccEEEcccccccccccccEEEEEEEcHHHHHHHHHHHHcccccccccccccEEEEEEEEEEEEccEEEccccccccccccccccccccccccccc
***************GHVNFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQDACIYDNYVLPKLYAKMQYCVSCAIHSHVVR*****************RRR**FACFY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFKRRNGGRNKHGRGHVNFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQDACIYDNYVLPKLYAKMQYCVSCAIHSHVVRVRSRTDRRNREPPKRFMRRRVSFACFY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S26-1 confidentP49206
40S ribosomal protein S26-3 confidentQ9LYK9
40S ribosomal protein S26 confidentO45499

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U5C, chain a
Confidence level:very confident
Coverage over the Query: 2-98
View the alignment between query and template
View the model in PyMOL