Citrus Sinensis ID: 033744

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MVDIDSQIPTSYDPFADIKDSLAPGDKGYVHLRVQQRNGKKCLTTVQGLKEDFGYQKILKDLKKEFCCNGNVVNDKVLGKVIQLQGDHRKNVMIFLVKSKIVDKDRIKIHGF
ccccccccccccccccccccccccccccEEEEEEEECcccEEEEEEccccccccHHHHHHHHHHHcccccEEEEcccccEEEEEEccHHHHHHHHHHHccccccccEEEccc
**D****IPTSYDPFADI******GDKGYVHLRVQQRNGKKCLTTVQGLKEDFGYQKILKDLKKEFCCNGNVVNDKVLGKVIQLQGDHRKNVMIFLVKSKIVDKDRIKIHGF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDIDSQIPTSYDPFADIKDSLAPGDKGYVHLRVQQRNGKKCLTTVQGLKEDFGYQKILKDLKKEFCCNGNVVNDKVLGKVIQLQGDHRKNVMIFLVKSKIVDKDRIKIHGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein translation factor sui1 Additional factor that functions in concert with eIF-2 and the initiator tRNA in directing the ribosome to the proper start site of translation.probableP79060
Eukaryotic translation initiation factor eIF-1 Additional factor that functions in concert with eIF-2 and the initiator tRNA in directing the ribosome to the proper start site of translation.probableP32911
Eukaryotic translation initiation factor 1 Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.probableQ5RFF4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IF1, chain A
Confidence level:very confident
Coverage over the Query: 1-112
View the alignment between query and template
View the model in PyMOL