Citrus Sinensis ID: 033769


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MASFEEAPPGNPKAGEKIFKTKCAQCHTVVKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKGMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA
cccccccccccHHHHHHHHHHHcHHcccccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcc
**********NPKAGEKIFKTKCAQCHTVVKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKGMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASFEEAPPGNPKAGEKIFKTKCAQCHTVVKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKGMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.confidentQ0DI31
Probable cytochrome c At4g10040 Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.confidentQ9T0G2
Cytochrome c Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.confidentP00051

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CCR, chain A
Confidence level:very confident
Coverage over the Query: 5-112
View the alignment between query and template
View the model in PyMOL