Citrus Sinensis ID: 033813

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MASMTMAAASLLPTSMAKNPAATRAKRGGLIVVAKAASSKAENVSMEFKNKDESSSNGRRELVFAAAAAAACSIAKVAMAESEEPKRGTPDAKKKYAPVCVTMPTARICRK
cccHHHHHHHHccccccccccccccccccEEEEEEHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccEEECccccHHHcc
********ASLLPT****************IV*****************************LVFAAAAAAACSIAKVAM****************YAPVCVTMPTARIC**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASMTMAAASLLPTSMAKNPAATRAKRGGLIVVAKAASSKAENVSMEFKNKDESSSNGRRELVFAAAAAAACSIAKVAMAESEEPKRGTPDAKKKYAPVCVTMPTARICRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem II 5 kDa protein, chloroplastic May be a component of the oxygen-evolving complex.probableQ39195
Photosystem II 5 kDa protein, chloroplastic May be a component of the oxygen-evolving complex.probableB3EWI4
Photosystem II 5 kDa protein, chloroplastic May be a component of the oxygen-evolving complex.probableP31336

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted