Citrus Sinensis ID: 033867

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MSGVWVFNTNGVIRLIENPQAESQGSSSSRRKVLVHLPTGEVVSSYSSLEQILTGLGWERYYGGDPDLFQFHKHSSIDLISLPRDFSKFNSVYMYDIVIKNPNVFHVRDM
cccEEEEccccEEEEEEccccccccccccccEEEEEcccccEEEcHHHHHHHHHHcccEECcccccccEEECccccCEEEEccccccccCEEEEEEEEEEcccEEEEEcc
MSGVWVFNTNGVIRLI****************VLVHLPTGEVVSSYSSLEQILTGLGWERYYGGDPDLFQFHKHSSIDLISLPRDFSKFNSVYMYDIVIKNPNVFHVRDM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGVWVFNTNGVIRLIENPQAESQGSSSSRRKVLVHLPTGEVVSSYSSLEQILTGLGWERYYGGDPDLFQFHKHSSIDLISLPRDFSKFNSVYMYDIVIKNPNVFHVRDM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flowering-promoting factor 1-like protein 2 Modulates the competence to flowering of apical meristems.confidentQ9LXB5
Flowering-promoting factor 1 Modulates the competence to flowering of apical meristems.probableO24340
Flowering-promoting factor 1-like protein 1 GTP-binding protein that functions in the development of rice root systems, which are mediated by auxin. Acts as a cell cycle regulator during root development. Proteasome-mediated degradation of the protein is necessary for the transition of metaphase to anaphase in mitosis.probableQ9LGE3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted