Citrus Sinensis ID: 033870


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MASNRGHGGIQQLLAAEQEAQHIVAAARNAKMARLRQAKEEAEREIAEHRAQVEREFQRKLAESSGDSGANVKRLEQETEVKIHHLNAGAEKIQYDVVQMLLKHVTTVKN
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
************LLAAEQEAQHIVAAARNAKMARLRQAKEEAEREIAEHRAQVERE************************VKIHHLNAGAEKIQYDVVQMLLKHVTTVKN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASNRGHGGIQQLLAAEQEAQHIVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLAESSGDSGANVKRLEQETEVKIHHLNAGAEKIQYDVVQMLLKHVTTVKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
V-type proton ATPase subunit G Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentQ9SP55
V-type proton ATPase subunit G1 Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentO82628
V-type proton ATPase subunit G 1 Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.probableO82702

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EFA, chain G
Confidence level:very confident
Coverage over the Query: 7-108
View the alignment between query and template
View the model in PyMOL