Citrus Sinensis ID: 033893

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVIGSFKTKKIEFRDFYEVEIFW
ccHHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHcccccCECcccccccEEEEEEccEEEEEEEccccccHHccHHHHHccccEEEEEEEcccccHHcccccc
MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVIGSFKTKKIEFRDFYEVEIFW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVIGSFKTKKIEFRDFYEVEIFW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GTP-binding protein SAR1B Involved in transport from the endoplasmic reticulum to the Golgi apparatus.confidentQ01474
GTP-binding protein SAR1B Involved in transport from the endoplasmic reticulum to the Golgi apparatus.probableO04267
GTP-binding protein SAR1A Involved in transport from the endoplasmic reticulum to the Golgi apparatus.probableO04266

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M2O, chain B
Confidence level:very confident
Coverage over the Query: 21-105
View the alignment between query and template
View the model in PyMOL