Citrus Sinensis ID: 033913

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISCQ
cHHHHHHHHcccccEEEEccccccccccccccccccCEEEEEEHHHHHcccccccEEEEECccEEEEEEEccccHHHHHHHHHccccccEEEEEEccHHHHHHHHcccc
******KLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISCQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial Plays a role in the inhibition of programmed cell death by converting the toxic proline catabolism intermediate (s)-1-pyrroline-5-carboxylate (P5C) to glutamate.probableQ8VZC3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y53, chain A
Confidence level:confident
Coverage over the Query: 2-108
View the alignment between query and template
View the model in PyMOL