Citrus Sinensis ID: 033913

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISCQ
cHHHHHHHHcccccEEEEccccccccccccccccccEEEEEEEHHHHHcccccccEEEEEEccEEEEEEEccccHHHHHHHHHccccccEEEEEEccHHHHHHHHcccc
cHHHHHHHHcccccEEEEccccccccccccccccccccEEEEEHHHHHccccccEEEEHccccEEEEEEcccccHHHHHHHHHHHHHHccEEEEcccHHHHHEEEEEcc
MLEHMNKLlkvpgskllfggeelknhsipsiygalkptavfvpleeilkdgnyelvtreifgpfQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISCQ
MLEHMNKllkvpgskLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISCQ
MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISCQ
*************SKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLI***
******KLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISC*
MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISCQ
MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISCQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQLQLISCQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q8VZC3556 Delta-1-pyrroline-5-carbo yes no 0.935 0.183 0.854 1e-45
Q40255551 Probable aldehyde dehydro N/A no 0.935 0.185 0.803 1e-43
>sp|Q8VZC3|AL121_ARATH Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial OS=Arabidopsis thaliana GN=ALDH12A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  181 bits (460), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 1/103 (0%)

Query: 1   MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDG-NYELVTRE 59
           MLEHM  LL++PGSKLLFGG+ELKNHSIPSIYGAL+PTAV+VP+EEILKD   YELVT+E
Sbjct: 382 MLEHMENLLQIPGSKLLFGGKELKNHSIPSIYGALEPTAVYVPIEEILKDNKTYELVTKE 441

Query: 60  IFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQ 102
           IFGPFQIVTEYK+DQLPLVL ALERMHAHLTAAVVSNDP+FLQ
Sbjct: 442 IFGPFQIVTEYKKDQLPLVLEALERMHAHLTAAVVSNDPIFLQ 484
Plays a role in the inhibition of programmed cell death by converting the toxic proline catabolism intermediate (s)-1-pyrroline-5-carboxylate (P5C) to glutamate.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q40255|ALDH_LINUS Probable aldehyde dehydrogenase OS=Linum usitatissimum GN=FIS1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
149938952 554 P5CDH1 [Actinidia chinensis] 0.935 0.184 0.862 3e-46
218963691 554 delta-1-pyrroline-5-carboxylate dehydrog 0.935 0.184 0.852 3e-45
218963693 554 delta-1-pyrroline-5-carboxylate dehydrog 0.935 0.184 0.852 3e-45
224124158 566 predicted protein [Populus trichocarpa] 0.963 0.185 0.819 6e-45
15383744 556 delta-1-pyrroline-5-carboxylate dehydrog 0.935 0.183 0.854 2e-44
255540941 584 1-pyrroline-5-carboxylate dehydrogenase, 0.935 0.174 0.823 2e-44
10178084 556 dehydrogenase [Arabidopsis thaliana] 0.935 0.183 0.854 4e-44
18424599 556 delta-1-pyrroline-5-carboxylate dehydrog 0.935 0.183 0.854 4e-44
297734012 546 unnamed protein product [Vitis vinifera] 0.935 0.186 0.823 5e-44
297797225 556 ALDH12A1 [Arabidopsis lyrata subsp. lyra 0.935 0.183 0.844 5e-44
>gi|149938952|gb|ABR45721.1| P5CDH1 [Actinidia chinensis] Back     alignment and taxonomy information
 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 97/102 (95%)

Query: 1   MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREI 60
           MLEHMNKLL++ GSKLLFGGE LKNHSIPSIYGA+KPTA+FVPLEE+LKD NYELVTREI
Sbjct: 381 MLEHMNKLLQISGSKLLFGGEALKNHSIPSIYGAIKPTAIFVPLEELLKDNNYELVTREI 440

Query: 61  FGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQ 102
           FGPFQI+TEYK  QLP+VL+ALERMHAHLTAA+VSNDPLFLQ
Sbjct: 441 FGPFQIITEYKDHQLPMVLDALERMHAHLTAAIVSNDPLFLQ 482

Source: Actinidia chinensis

Species: Actinidia chinensis

Genus: Actinidia

Family: Actinidiaceae

Order: Ericales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|218963691|gb|ACL13549.1| delta-1-pyrroline-5-carboxylate dehydrogenase protein [Malus x domestica] Back     alignment and taxonomy information
>gi|218963693|gb|ACL13550.1| delta-1-pyrroline-5-carboxylate dehydrogenase 1 protein [Malus x domestica] Back     alignment and taxonomy information
>gi|224124158|ref|XP_002330119.1| predicted protein [Populus trichocarpa] gi|222871253|gb|EEF08384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15383744|gb|AAK73756.1| delta-1-pyrroline-5-carboxylate dehydrogenase precursor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255540941|ref|XP_002511535.1| 1-pyrroline-5-carboxylate dehydrogenase, putative [Ricinus communis] gi|223550650|gb|EEF52137.1| 1-pyrroline-5-carboxylate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|10178084|dbj|BAB11503.1| dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18424599|ref|NP_568955.1| delta-1-pyrroline-5-carboxylate dehydrogenase 12A1 [Arabidopsis thaliana] gi|75248520|sp|Q8VZC3.1|AL121_ARATH RecName: Full=Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial; Short=AtP5CDH; Short=P5C dehydrogenase; AltName: Full=Aldehyde dehydrogenase family 12 member A1; Flags: Precursor gi|17473533|gb|AAL38248.1| dehydrogenase [Arabidopsis thaliana] gi|23397209|gb|AAN31887.1| putative dehydrogenase [Arabidopsis thaliana] gi|34098903|gb|AAQ56834.1| At5g62530 [Arabidopsis thaliana] gi|332010236|gb|AED97619.1| delta-1-pyrroline-5-carboxylate dehydrogenase 12A1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297734012|emb|CBI15259.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297797225|ref|XP_002866497.1| ALDH12A1 [Arabidopsis lyrata subsp. lyrata] gi|297312332|gb|EFH42756.1| ALDH12A1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
TAIR|locus:2154094556 ALDH12A1 "AT5G62530" [Arabidop 0.935 0.183 0.854 3.5e-43
TAIR|locus:2154094 ALDH12A1 "AT5G62530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 456 (165.6 bits), Expect = 3.5e-43, P = 3.5e-43
 Identities = 88/103 (85%), Positives = 97/103 (94%)

Query:     1 MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGN-YELVTRE 59
             MLEHM  LL++PGSKLLFGG+ELKNHSIPSIYGAL+PTAV+VP+EEILKD   YELVT+E
Sbjct:   382 MLEHMENLLQIPGSKLLFGGKELKNHSIPSIYGALEPTAVYVPIEEILKDNKTYELVTKE 441

Query:    60 IFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQ 102
             IFGPFQIVTEYK+DQLPLVL ALERMHAHLTAAVVSNDP+FLQ
Sbjct:   442 IFGPFQIVTEYKKDQLPLVLEALERMHAHLTAAVVSNDPIFLQ 484


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.321   0.139   0.399    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      109       109   0.00091  102 3  11 22  0.43    30
                                                     29  0.41    32


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  514 (55 KB)
  Total size of DFA:  105 KB (2073 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  12.48u 0.16s 12.64t   Elapsed:  00:00:01
  Total cpu time:  12.48u 0.16s 12.64t   Elapsed:  00:00:01
  Start:  Fri May 10 08:07:12 2013   End:  Fri May 10 08:07:13 2013
GO:0004028 "3-chloroallyl aldehyde dehydrogenase activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0003842 "1-pyrroline-5-carboxylate dehydrogenase activity" evidence=IGI;IMP
GO:0006560 "proline metabolic process" evidence=TAS
GO:0009507 "chloroplast" evidence=IDA
GO:0010133 "proline catabolic process to glutamate" evidence=IMP
GO:0009651 "response to salt stress" evidence=IEP
GO:0072593 "reactive oxygen species metabolic process" evidence=IMP
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VZC3AL121_ARATH1, ., 5, ., 1, ., 1, 20.85430.93570.1834yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
cd07126489 cd07126, ALDH_F12_P5CDH, Delta(1)-pyrroline-5-carb 2e-58
cd07084442 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+ 1e-33
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 9e-10
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 1e-05
>gnl|CDD|143444 cd07126, ALDH_F12_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information 
 Score =  186 bits (473), Expect = 2e-58
 Identities = 76/102 (74%), Positives = 90/102 (88%)

Query: 1   MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREI 60
           +L+H++KLL +PG+K+LFGG+ L NHSIPSIYGA +PTAVFVPLEEI  + N+ELVT E+
Sbjct: 328 ILDHVDKLLAIPGAKVLFGGKPLTNHSIPSIYGAYEPTAVFVPLEEIAIEENFELVTTEV 387

Query: 61  FGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQ 102
           FGPFQ+VTEYK +QLPLVL ALERMHAHLTAAVVSND  FLQ
Sbjct: 388 FGPFQVVTEYKDEQLPLVLEALERMHAHLTAAVVSNDIRFLQ 429

Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH, EC=1.5.1.12), family 12: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. P5CDH is a mitochondrial enzyme involved in proline degradation and catalyzes the NAD + -dependent conversion of P5C to glutamate. The P5CDH, ALDH12A1 gene, in Arabidopsis, has been identified as an osmotic-stress-inducible ALDH gene. This CD contains both Viridiplantae and Alveolata P5CDH sequences. Length = 489
>gnl|CDD|143403 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG2450501 consensus Aldehyde dehydrogenase [Energy productio 99.89
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 99.87
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 99.86
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 99.85
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 99.85
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 99.85
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 99.83
PLN02174484 aldehyde dehydrogenase family 3 member H1 99.83
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 99.83
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 99.82
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 99.82
PLN02315508 aldehyde dehydrogenase family 7 member 99.82
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 99.82
PLN02766501 coniferyl-aldehyde dehydrogenase 99.82
PLN02278498 succinic semialdehyde dehydrogenase 99.82
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 99.81
PRK10090409 aldehyde dehydrogenase A; Provisional 99.81
PLN02466538 aldehyde dehydrogenase family 2 member 99.81
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 99.81
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 99.81
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 99.81
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 99.81
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 99.81
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 99.81
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 99.81
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 99.81
KOG2455561 consensus Delta-1-pyrroline-5-carboxylate dehydrog 99.81
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 99.81
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 99.81
KOG2451503 consensus Aldehyde dehydrogenase [Energy productio 99.81
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 99.8
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 99.8
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 99.8
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 99.8
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 99.8
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 99.8
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 99.8
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 99.8
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 99.8
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 99.79
PRK13252488 betaine aldehyde dehydrogenase; Provisional 99.79
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 99.79
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 99.79
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 99.79
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 99.79
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 99.79
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 99.79
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 99.79
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 99.79
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 99.79
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 99.79
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 99.79
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 99.78
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 99.78
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 99.78
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 99.78
PRK11903521 aldehyde dehydrogenase; Provisional 99.78
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 99.78
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 99.78
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 99.78
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 99.78
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 99.78
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 99.78
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 99.78
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 99.78
PLN02467503 betaine aldehyde dehydrogenase 99.78
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 99.78
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 99.78
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 99.78
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 99.78
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 99.78
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 99.78
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 99.78
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 99.78
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 99.78
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 99.78
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 99.78
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 99.77
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 99.77
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 99.77
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 99.77
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 99.77
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 99.77
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 99.77
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 99.77
PTZ00381 493 aldehyde dehydrogenase family protein; Provisional 99.77
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 99.77
PLN02203484 aldehyde dehydrogenase 99.77
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 99.77
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 99.77
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 99.76
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 99.76
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 99.76
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 99.76
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 99.76
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 99.76
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 99.75
KOG2454583 consensus Betaine aldehyde dehydrogenase [Energy p 99.75
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 99.75
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 99.75
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 99.75
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 99.74
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 99.74
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 99.74
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 99.73
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 99.73
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 99.73
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 99.72
PRK11809 1318 putA trifunctional transcriptional regulator/proli 99.7
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 99.69
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 99.69
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 99.69
KOG2452881 consensus Formyltetrahydrofolate dehydrogenase [Nu 99.68
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 99.68
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 99.67
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 99.67
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 99.65
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 99.65
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 99.62
KOG2456477 consensus Aldehyde dehydrogenase [Energy productio 99.61
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 99.6
PRK15398465 aldehyde dehydrogenase EutE; Provisional 99.57
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.56
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 99.45
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 99.44
KOG2453507 consensus Aldehyde dehydrogenase [Energy productio 99.41
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 99.32
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 99.31
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 99.23
KOG2449157 consensus Methylmalonate semialdehyde dehydrogenas 99.18
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 99.13
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 99.11
>KOG2450 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information 
Probab=99.89  E-value=9.1e-24  Score=173.19  Aligned_cols=94  Identities=26%  Similarity=0.305  Sum_probs=81.6

Q ss_pred             HHHHHHHhcCCCcEEEeCCcccCCCCCCCCcceeeceEEecccchhccCCCccccceeeeecceEEEEecCCCHHHHHHH
Q 033913            2 LEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNA   81 (109)
Q Consensus         2 ~~~v~~~~~~~G~~~l~gG~~~~~~~~~~~~~~v~PTv~~~~~~~~~~~~~~~~~~eEiFGPv~~v~~y~~~~~eEai~~   81 (109)
                      +++|+++++ +|+++++||.+.+     ..|+||.|||+. ++.     ++|+|++|||||||++|++|++.  ||+|++
T Consensus       355 ~~yi~~~k~-eGa~l~~gG~~~g-----~~Gyfi~Ptv~~-~v~-----~~m~i~~EEIFGPVv~v~~F~t~--eE~i~~  420 (501)
T KOG2450|consen  355 LGYIESGKK-EGATLLCGGVRLG-----DKGYFIKPTVFT-NVT-----DDMRIAKEEIFGPVVVVLKFKTE--EEVIER  420 (501)
T ss_pred             HHHHHHHHh-cCCEEEecCcccC-----CCceEECCeecc-CCC-----hhhhhhHhhccCceEEEEecCcH--HHHHHH
Confidence            678888888 6999999997643     355799999863 322     47999999999999999999976  999999


Q ss_pred             HhcCCCCceEEEecCCHHHHHHHHHhcC
Q 033913           82 LERMHAHLTAAVVSNDPLFLQLQLISCQ  109 (109)
Q Consensus        82 an~~~~gLta~Vfs~d~~~~~~~~~~~~  109 (109)
                      ||+++|||+|+|||+|.+++++++...|
T Consensus       421 AN~t~yGLAa~V~t~dl~~a~~va~~l~  448 (501)
T KOG2450|consen  421 ANNTTYGLAAGVFTKDLDKAHRVANALQ  448 (501)
T ss_pred             hcCCcccceeeEeccChHHHHHHHHHhc
Confidence            9999999999999999999999987654

>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>KOG2455 consensus Delta-1-pyrroline-5-carboxylate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>KOG2451 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>KOG2454 consensus Betaine aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>KOG2452 consensus Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>KOG2456 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>KOG2453 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>KOG2449 consensus Methylmalonate semialdehyde dehydrogenase [Amino acid transport and metabolism; Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 2e-04
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
 Score = 38.1 bits (89), Expect = 2e-04
 Identities = 14/97 (14%), Positives = 25/97 (25%), Gaps = 16/97 (16%)

Query: 2   LEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIF 61
              +       G  + F   E            +         E   K         EIF
Sbjct: 332 QSQVVSRGSDDGIDVTFSQAES---------PCVASALFVTSSENWRKH---PAWEEEIF 379

Query: 62  GPFQIVTEYK-QDQLPLVLNALERMHAHLTAAVVSND 97
           GP  ++   +    +  +   L      LTA + + +
Sbjct: 380 GPQSLIVVCENVADMLSLSEMLA---GSLTATIHATE 413

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 99.87
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 99.86
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 99.86
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 99.85
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 99.85
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 99.84
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 99.84
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 99.84
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 99.84
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 99.84
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 99.84
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 99.84
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 99.84
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 99.84
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 99.83
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 99.83
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 99.83
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 99.83
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 99.83
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 99.83
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 99.82
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 99.82
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 99.82
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 99.82
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 99.82
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 99.82
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 99.82
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 99.82
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 99.82
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 99.82
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 99.82
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 99.81
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 99.81
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 99.81
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 99.81
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 99.81
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 99.81
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 99.8
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 99.8
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 99.79
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 99.79
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 99.79
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 99.78
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 99.78
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 99.77
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 99.73
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 99.62
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 99.58
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 99.58
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 99.55
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 99.38
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 99.35
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
Probab=99.87  E-value=1.9e-22  Score=164.56  Aligned_cols=97  Identities=21%  Similarity=0.253  Sum_probs=79.7

Q ss_pred             HHHHHHHhcCCCcEEEeCCcccCCCCCCCCcceeeceEEecccchhccCCCccccceeeeecceEEEEecCCCHHHHHHH
Q 033913            2 LEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNA   81 (109)
Q Consensus         2 ~~~v~~~~~~~G~~~l~gG~~~~~~~~~~~~~~v~PTv~~~~~~~~~~~~~~~~~~eEiFGPv~~v~~y~~~~~eEai~~   81 (109)
                      .++++++++ +|+++++||....... ...|+|++|||+... +     +++++++||+||||++|++|+|+  ||||++
T Consensus       338 ~~~i~~a~~-~Ga~v~~gG~~~~~~~-~~~G~~~~Ptvl~~v-~-----~~~~i~~eEiFGPVl~v~~~~~~--deAi~~  407 (490)
T 2wme_A          338 LGYIESGKA-QKARLLCGGERVTDGA-FGKGAYVAPTVFTDC-R-----DDMTIVREEIFGPVMSILVYDDE--DEAIRR  407 (490)
T ss_dssp             HHHHHHHHH-TTCEEEECCSBCCTTT-GGGTTCBCCEEEESC-C-----TTSHHHHSCCCSSEEEEEEESCH--HHHHHH
T ss_pred             HHHHHHHHh-cCCEEEECCcccCccc-ccCCCccCCEEEEcC-C-----CCChhhhccccCCEEEEEEeCCH--HHHHHH
Confidence            356777776 6999999997643211 123568999997532 1     46899999999999999999965  999999


Q ss_pred             HhcCCCCceEEEecCCHHHHHHHHHhc
Q 033913           82 LERMHAHLTAAVVSNDPLFLQLQLISC  108 (109)
Q Consensus        82 an~~~~gLta~Vfs~d~~~~~~~~~~~  108 (109)
                      +|+++|||+++|||+|.+++++++.+.
T Consensus       408 aN~~~yGL~a~v~t~d~~~a~~~~~~l  434 (490)
T 2wme_A          408 ANDTEYGLAAGVVTQDLARAHRAIHRL  434 (490)
T ss_dssp             HHCSSCCSEEEEECSBHHHHHHHHHHS
T ss_pred             HhcCCCCCeEEEEcCCHHHHHHHHHHC
Confidence            999999999999999999999998865
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-04
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 0.002
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Baltic cod (Gadus callarias) [TaxId: 8053]

 Score = 37.4 bits (86), Expect = 1e-04
 Identities = 20/89 (22%), Positives = 32/89 (35%), Gaps = 13/89 (14%)

Query: 13  GSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQ 72
           G+++L GGE L         G      V     +     +   V  EIFGP   V  +  
Sbjct: 359 GARVLCGGEPLTPSDPKLKNGYFMSPCVLDNCRD-----DMTCVKEEIFGPVMSVLPFDT 413

Query: 73  DQLPLVLNALERMHAH---LTAAVVSNDP 98
           ++       L+R +     L + V + D 
Sbjct: 414 EE-----EVLQRANNTTFGLASGVFTRDI 437
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 99.84
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 99.84
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 99.82
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 99.81
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 99.79
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 99.72
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 99.7
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 99.65
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 99.6
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 99.5
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 98.99
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]

Probab=99.84  E-value=1.5e-21  Score=156.30  Aligned_cols=94  Identities=24%  Similarity=0.240  Sum_probs=78.7

Q ss_pred             HHHHHHHhcCCCcEEEeCCcccCCCCCCCCcceeeceEEecccchhccCCCccccceeeeecceEEEEecCCCHHHHHHH
Q 033913            2 LEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNA   81 (109)
Q Consensus         2 ~~~v~~~~~~~G~~~l~gG~~~~~~~~~~~~~~v~PTv~~~~~~~~~~~~~~~~~~eEiFGPv~~v~~y~~~~~eEai~~   81 (109)
                      .++++++++ +|+++++||....+     .|+|++|||+....      +++.+++||+||||++|++|++  +||+|++
T Consensus       348 ~~~i~~a~~-~Ga~vl~gg~~~~~-----~g~~~~Ptvl~~~~------~~~~~~~eE~FGPvl~v~~~~~--~~eai~~  413 (494)
T d1o04a_         348 LGYINTGKQ-EGAKLLCGGGIAAD-----RGYFIQPTVFGDVQ------DGMTIAKEEIFGPVMQILKFKT--IEEVVGR  413 (494)
T ss_dssp             HHHHHHHHH-TTCEEEECCSBCCS-----SSSCBCCEEEESCC------TTSHHHHSCCCSSEEEEEEECC--HHHHHHH
T ss_pred             HHHHHHHHH-CCCEEEECCCcCCC-----CCceEcCEEEeCCC------CCCHHHhccccCceEEEEEeCC--HHHHHHH
Confidence            356677776 69999999976442     34589999985321      4689999999999999999995  5999999


Q ss_pred             HhcCCCCceEEEecCCHHHHHHHHHhcC
Q 033913           82 LERMHAHLTAAVVSNDPLFLQLQLISCQ  109 (109)
Q Consensus        82 an~~~~gLta~Vfs~d~~~~~~~~~~~~  109 (109)
                      +|+++||||++|||+|.+++.+++.+.+
T Consensus       414 an~~~~gL~a~i~s~d~~~~~~~~~~l~  441 (494)
T d1o04a_         414 ANNSTYGLAAAVFTKDLDKANYLSQALQ  441 (494)
T ss_dssp             HHCSSCCSEEEEECSBHHHHHHHHHHCC
T ss_pred             HhCCCCCCeEEEEeCCHHHHHHHHHhCC
Confidence            9999999999999999999999988753
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure