Citrus Sinensis ID: 033914

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MLDAVRLNMRIRGRIAVCGMISQYNLEKSEGVHNLMQVVGKRIRMEGFLAGDFYHQYPKFLELVMRAIKEGKLVYVEDIAEGLEKAPSALVGIFTGQNVGKQLVVIARE
cHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHcccEEEEEEHHHHHccHHHHHHHccccccccEEEEEEccc
MLDAVRLNMRIRGRIAVCGMISQYNLEKSEGVHNLMQVVGKRIRMEGFLAGDFYHQYPKFLELVMRAIKEGKLVYVEDIAEGLEKAPSALVGIFTGQNVGKQLVVIAR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDAVRLNMRIRGRIAVCGMISQYNLEKSEGVHNLMQVVGKRIRMEGFLAGDFYHQYPKFLELVMRAIKEGKLVYVEDIAEGLEKAPSALVGIFTGQNVGKQLVVIARE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADP-dependent alkenal double bond reductase P2 Catalyzes the reduction of the 7-8 double bond of phenylpropanal substrates, such as p-coumaryl aldehyde and coniferyl aldehyde (in vitro). Has activity towards toxic substrates, such as 4-hydroxy-(2E)-nonenal (in vitro) (By similarity). May play a distinct role in plant antioxidant defense and is possibly involved in NAD(P)/NAD(P)h homeostasis.probableQ39173

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J3H, chain A
Confidence level:very confident
Coverage over the Query: 2-109
View the alignment between query and template
View the model in PyMOL