Citrus Sinensis ID: 033947

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MSLLQFSSTTVRSPTSVPCSGNHQITASAFSAGVSSSRTGSYSSSLVAKKANKKSNKQLNGGVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW
cccEEEEccCECcccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEEEEHEEcccCEEEEEEEccccccHHHHHccccEEEEEccccc
************************************************************GGVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLQFSSTTVRSPTSVPCSGNHQITASAFSAGVSSSRTGSYSSSLVAKKANKKSNKQLNGGVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin F2, chloroplastic Probable thiol-disulfide oxidoreductase involved in the redox regulation of enzymes of both reductive pentose phosphate pathway (Calvin-Benson cycle) and oxidative pentose phosphate pathway.probableQ9XFH9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FAA, chain A
Confidence level:confident
Coverage over the Query: 75-108
View the alignment between query and template
View the model in PyMOL