Citrus Sinensis ID: 033947

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MSLLQFSSTTVRSPTSVPCSGNHQITASAFSAGVSSSRTGSYSSSLVAKKANKKSNKQLNGGVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW
cccEEEEccEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEEEHEEcccEEEEEEEEccccccHHHHHccccEEEEEccccc
ccEEEEEEcccccccccccccccccccccccccccccccccHcccHHHHHHHHHHHHcccccEEEEEEcccccccccccEEEEccccHHHHHHccccccEEEEEEccc
msllqfssttvrsptsvpcsgnhqitasafsagvsssrtgsyssSLVAKKAnkksnkqlnggvfTVRSSLEIagatvgevtevnkdtFWPIVKAAGDKTVVLDMYTQW
msllqfssttvrsptsvpcsGNHQITASafsagvsssRTGSYSSSLVakkankksnkqlnggvftVRSSLEIAGatvgevtevnkdtfwpivkaagdktVVLDMYTQW
MSLLQFssttvrsptsvpcsGNHQITASAFsagvsssrtgsysssLVAKKANKKSNKQLNGGVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW
************************************************************GGVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMY***
*****************************************************************VRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW
*******************SGNHQITASAF*************************NKQLNGGVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW
************************************S*T*****S*VAKKA*KKS***LNGGVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLQFSSTTVRSPTSVPCSGNHQITASAFSAGVSSSRTGSYSSSLVAKKANKKSNKQLNGGVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query108 2.2.26 [Sep-21-2011]
Q9XFH9185 Thioredoxin F2, chloropla yes no 0.435 0.254 0.765 6e-15
P09856190 Thioredoxin F-type, chlor N/A no 0.509 0.289 0.603 4e-14
Q9XFH8178 Thioredoxin F1, chloropla no no 0.398 0.241 0.767 8e-14
O48897182 Thioredoxin F-type, chlor N/A no 0.75 0.445 0.494 1e-13
P29450182 Thioredoxin F-type, chlor N/A no 0.361 0.214 0.804 5e-12
O81332191 Thioredoxin F-type, chlor N/A no 0.620 0.350 0.5 2e-11
Q8S091187 Thioredoxin F, chloroplas yes no 0.333 0.192 0.805 4e-11
>sp|Q9XFH9|TRXF2_ARATH Thioredoxin F2, chloroplastic OS=Arabidopsis thaliana GN=At5g16400 PE=2 SV=1 Back     alignment and function desciption
 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 36/47 (76%), Positives = 38/47 (80%)

Query: 62  GVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW 108
           G   VR SLE    TVG+VTEV+KDTFWPIVKAAGDK VVLDMYTQW
Sbjct: 62  GSCVVRCSLETVNVTVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQW 108
Probable thiol-disulfide oxidoreductase involved in the redox regulation of enzymes of both reductive pentose phosphate pathway (Calvin-Benson cycle) and oxidative pentose phosphate pathway.
Arabidopsis thaliana (taxid: 3702)
>sp|P09856|TRXF_SPIOL Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 Back     alignment and function description
>sp|Q9XFH8|TRXF1_ARATH Thioredoxin F1, chloroplastic OS=Arabidopsis thaliana GN=At3g02730 PE=1 SV=2 Back     alignment and function description
>sp|O48897|TRXF_BRANA Thioredoxin F-type, chloroplastic OS=Brassica napus GN=TRXF PE=2 SV=1 Back     alignment and function description
>sp|P29450|TRXF_PEA Thioredoxin F-type, chloroplastic OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|O81332|TRXF_MESCR Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 Back     alignment and function description
>sp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
449442647180 PREDICTED: thioredoxin F2, chloroplastic 0.777 0.466 0.566 8e-17
255547546186 thioredoxin f-type, putative [Ricinus co 0.907 0.526 0.478 4e-16
217071258186 unknown [Medicago truncatula] gi|3885140 0.435 0.252 0.816 2e-14
357507807182 Thioredoxin [Medicago truncatula] gi|355 0.435 0.258 0.816 3e-14
15237341185 thioredoxin F2 [Arabidopsis thaliana] gi 0.435 0.254 0.765 3e-13
224146173188 thioredoxin f [Populus trichocarpa] gi|1 0.953 0.547 0.478 3e-13
388520393179 unknown [Lotus japonicus] 0.435 0.262 0.795 4e-13
388498704179 unknown [Lotus japonicus] 0.435 0.262 0.795 4e-13
297811781186 ATF2/TRXF2 [Arabidopsis lyrata subsp. ly 0.435 0.252 0.723 5e-13
225430920172 PREDICTED: thioredoxin F, chloroplastic 0.379 0.238 0.829 1e-12
>gi|449442647|ref|XP_004139092.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] gi|449476195|ref|XP_004154668.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 61/90 (67%), Gaps = 6/90 (6%)

Query: 19  CSGNHQITASAFSAGVSSSRTGSYSSSLVAKKANKKSNKQLNGGVFTVRSSLEIAGATVG 78
           CSG   I      A +S S++G +SS  ++  +++        G F V SSLE AGATVG
Sbjct: 20  CSGRQPI------ATLSESKSGCFSSRSLSLSSSRSIGVSGRNGSFKVNSSLETAGATVG 73

Query: 79  EVTEVNKDTFWPIVKAAGDKTVVLDMYTQW 108
           +VTEVNKDTFWPIV AAGDKTVVLDMYTQW
Sbjct: 74  QVTEVNKDTFWPIVNAAGDKTVVLDMYTQW 103

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255547546|ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus communis] gi|223545881|gb|EEF47384.1| thioredoxin f-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|217071258|gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK45100.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357507807|ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|355499207|gb|AES80410.1| Thioredoxin [Medicago truncatula] Back     alignment and taxonomy information
>gi|15237341|ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|11135405|sp|Q9XFH9.1|TRXF2_ARATH RecName: Full=Thioredoxin F2, chloroplastic; Short=AtTrxf2; AltName: Full=Thioredoxin F1; Short=AtTrxf1; Flags: Precursor gi|4973254|gb|AAD35004.1|AF144386_1 thioredoxin f2 [Arabidopsis thaliana] gi|13878187|gb|AAK44171.1|AF370356_1 putative thioredoxin f2 protein [Arabidopsis thaliana] gi|9759122|dbj|BAB09607.1| thioredoxin f2 [Arabidopsis thaliana] gi|16323396|gb|AAL15192.1| putative thioredoxin f2 protein [Arabidopsis thaliana] gi|332004905|gb|AED92288.1| thioredoxin F2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224146173|ref|XP_002325907.1| thioredoxin f [Populus trichocarpa] gi|118488397|gb|ABK96015.1| unknown [Populus trichocarpa] gi|222862782|gb|EEF00289.1| thioredoxin f [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388520393|gb|AFK48258.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388498704|gb|AFK37418.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|297811781|ref|XP_002873774.1| ATF2/TRXF2 [Arabidopsis lyrata subsp. lyrata] gi|297319611|gb|EFH50033.1| ATF2/TRXF2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225430920|ref|XP_002277021.1| PREDICTED: thioredoxin F, chloroplastic [Vitis vinifera] gi|297735248|emb|CBI17610.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
TAIR|locus:2171322185 TRXF2 "thioredoxin F2" [Arabid 0.435 0.254 0.765 1.4e-14
TAIR|locus:2075522178 TRXF1 "thioredoxin F-type 1" [ 0.444 0.269 0.708 1.3e-13
UNIPROTKB|P09856190 P09856 "Thioredoxin F-type, ch 0.5 0.284 0.629 1.6e-13
TAIR|locus:2171322 TRXF2 "thioredoxin F2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 186 (70.5 bits), Expect = 1.4e-14, P = 1.4e-14
 Identities = 36/47 (76%), Positives = 38/47 (80%)

Query:    62 GVFTVRSSLEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW 108
             G   VR SLE    TVG+VTEV+KDTFWPIVKAAGDK VVLDMYTQW
Sbjct:    62 GSCVVRCSLETVNVTVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQW 108
GO:0006662 "glycerol ether metabolic process" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0008047 "enzyme activator activity" evidence=IDA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA;IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2075522 TRXF1 "thioredoxin F-type 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P09856 P09856 "Thioredoxin F-type, chloroplastic" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9XFH9TRXF2_ARATHNo assigned EC number0.76590.43510.2540yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
TRXF2
ATF2; enzyme activator; Encodes an f-type thioredoxin (Trx-f2) localized in chloroplast stroma. ; Participates in various redox reactions through the reversible oxidation of the active center dithiol to a disulfide. The F form is known to activate a number of enzymes of the photosynthetic carbon cycle (By similarity) (185 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
PSBQA
oxygen-evolving enhancer protein 3, chloroplast, putative (PSBQ1) (PSBQ); Encodes the PsbQ subu [...] (224 aa)
   •  • 0.855
TRXF1
TRXF1 (THIOREDOXIN F-TYPE 1); enzyme activator; THIOREDOXIN F-TYPE 1 (TRXF1); FUNCTIONS IN- enz [...] (178 aa)
  ••  ••0.824
PSBO2
PSBO2 (PHOTOSYSTEM II SUBUNIT O-2); oxygen evolving/ poly(U) binding; Encodes a protein which i [...] (331 aa)
   •  • 0.819
AT1G21500
unknown protein; unknown protein; LOCATED IN- 1-phosphatidylinositol-4-phosphate 3-kinase, clas [...] (126 aa)
   •    0.819
AT2G43560
immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein; immunophilin / FKB [...] (223 aa)
   •    0.796
LHCA6
LHCA6; chlorophyll binding; PSI type II chlorophyll a/b-binding protein (Lhca2*1) mRNA, (270 aa)
   •  • 0.790
CHLM
CHLM (magnesium-protoporphyrin IX methyltransferase); magnesium protoporphyrin IX methyltransfe [...] (312 aa)
   •    0.788
ATHM1
ATHM1; enzyme activator; encodes a chloroplast thioredoxin similar to prokaryotic thioredoxins. [...] (179 aa)
  ••  ••0.784
PSAD-2
PSAD-2 (photosystem I subunit D-2); Encodes a protein predicted by sequence similarity with spi [...] (204 aa)
   •    0.782
PETE1
PETE1 (PLASTOCYANIN 1); copper ion binding / electron carrier; One of two Arabidopsis plastocya [...] (171 aa)
   •    0.778

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 108
cd02962152 TMX2 TMX2 family; composed of proteins similar to 97.15
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 97.14
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 97.09
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 96.81
PRK10996139 thioredoxin 2; Provisional 96.73
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 96.38
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 95.89
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 95.6
PRK00293571 dipZ thiol:disulfide interchange protein precursor 95.26
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 94.46
PTZ00443 224 Thioredoxin domain-containing protein; Provisional 94.3
COG4232569 Thiol:disulfide interchange protein [Posttranslati 94.11
PLN02309457 5'-adenylylsulfate reductase 94.05
PTZ00102477 disulphide isomerase; Provisional 93.61
COG3118 304 Thioredoxin domain-containing protein [Posttransla 93.24
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 90.42
cd03008 146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 90.2
PTZ00102 477 disulphide isomerase; Provisional 90.03
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 89.98
PLN02399 236 phospholipid hydroperoxide glutathione peroxidase 88.49
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 87.11
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 85.66
PRK15412 185 thiol:disulfide interchange protein DsbE; Provisio 84.71
PF08534 146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 84.69
TIGR02740271 TraF-like TraF-like protein. This protein is relat 83.46
PLN02412 167 probable glutathione peroxidase 82.69
cd03014 143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 82.08
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 81.27
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 80.96
PTZ00056 199 glutathione peroxidase; Provisional 80.17
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information 
Probab=97.15  E-value=0.00052  Score=50.32  Aligned_cols=31  Identities=13%  Similarity=0.283  Sum_probs=27.4

Q ss_pred             ceeeecChhhHHHHHHhcCCcEEEEEeeeeC
Q 033947           78 GEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW  108 (108)
Q Consensus        78 g~V~e~dkddF~~~Lk~AGDKLVVVDF~AtW  108 (108)
                      ..+.+.+.++|++.+++.++++|||+|||+|
T Consensus        28 ~~v~~l~~~~f~~~l~~~~~~~vvV~Fya~w   58 (152)
T cd02962          28 EHIKYFTPKTLEEELERDKRVTWLVEFFTTW   58 (152)
T ss_pred             CccEEcCHHHHHHHHHhcCCCEEEEEEECCC
Confidence            4566788899999998888899999999999

It contains a TRX domain but the redox active CXXC motif is replaced with SXXC. Sequence analysis predicts that TMX2 may be a Type I membrane protein, with its C-terminal half protruding on the luminal side of the endoplasmic reticulum (ER). In addition to the TRX domain, transmembrane region and ER-retention signal, TMX2 also contains a Myb DNA-binding domain repeat signature and a dileucine motif in the tail.
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
1faa_A124 Crystal Structure Of Thioredoxin F From Spinach Chl 1e-12
1f9m_A112 Crystal Structure Of Thioredoxin F From Spinach Chl 1e-12
2pu9_C111 Crystal Srtucture Of The Binary Complex Between Fer 1e-12
>pdb|1FAA|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Long Form) Length = 124 Back     alignment and structure 
Iteration: 1

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%)
Query: 75  ATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW 108
           A VG+VTEVNKDTFWPIVKAAGDK VVLDM+TQW
Sbjct: 15  AIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQW 48
>pdb|1F9M|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Short Form) Length = 112 Back     alignment and structure
>pdb|2PU9|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin: Thioredoxin Reductase And Thioredoxin F Length = 111 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 6e-10
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 2e-09
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 2e-04
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 3e-04
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 6e-04
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
 Score = 51.6 bits (124), Expect = 6e-10
 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 2/48 (4%)

Query: 63  VFTVRSSLEIAG--ATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW 108
           ++ +  +L      A VG+VTEVNKDTFWPIVKAAGDK VVLDM+TQW
Sbjct: 1   MYYLELALGTQEMEAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQW 48
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
2av4_A 160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 97.95
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 97.83
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 97.78
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 97.78
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.7
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 97.64
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 97.6
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 97.47
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 97.46
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 97.45
2wz9_A 153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 97.43
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 97.25
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 97.24
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 97.16
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 97.14
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 97.1
2qsi_A137 Putative hydrogenase expression/formation protein; 97.1
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 97.09
1a0r_P 245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 97.09
2l5l_A136 Thioredoxin; structural genomics, electron transpo 97.07
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 97.05
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 97.03
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 97.01
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 96.99
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 96.98
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 96.98
3f9u_A 172 Putative exported cytochrome C biogenesis-related; 96.9
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 96.86
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 96.84
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 96.74
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 96.73
1wmj_A130 Thioredoxin H-type; structural genomics, program f 96.73
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 96.72
3dxb_A 222 Thioredoxin N-terminally fused to PUF60(UHM); spli 96.72
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 96.69
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 96.62
1zma_A118 Bacterocin transport accessory protein; alpha-beta 96.62
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 96.61
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 96.61
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 96.59
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 96.55
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 96.54
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 96.51
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 96.38
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 96.28
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 96.28
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 96.28
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 96.26
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 96.1
1z6n_A 167 Hypothetical protein PA1234; alpha-beta-alpha sand 96.1
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 95.89
3ga4_A 178 Dolichyl-diphosphooligosaccharide-protein glycosyl 95.76
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 95.7
2kuc_A130 Putative disulphide-isomerase; structural genomics 95.63
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 95.6
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 95.36
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 95.2
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 94.97
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 94.88
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 94.83
3ira_A 173 Conserved protein; methanosarcina mazei,structural 94.59
3lor_A 160 Thiol-disulfide isomerase and thioredoxins; PSI, M 94.55
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 94.53
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 94.23
1sen_A 164 Thioredoxin-like protein P19; endoplasmic reticulu 94.18
3eyt_A 158 Uncharacterized protein SPOA0173; thioredoxin-like 94.1
3ewl_A 142 Uncharacterized conserved protein BF1870; alpha-be 94.07
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 93.98
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 93.74
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 93.63
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 93.5
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 93.5
3s9f_A 165 Tryparedoxin; thioredoxin fold, disulfide reductas 93.41
1i5g_A 144 Tryparedoxin II; electron transport; HET: TS5; 1.4 93.31
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 93.06
3cmi_A 171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 93.01
2p5q_A 170 Glutathione peroxidase 5; thioredoxin fold, oxidor 92.96
3fw2_A 150 Thiol-disulfide oxidoreductase; structural genomic 92.95
2v1m_A 169 Glutathione peroxidase; selenium, selenocysteine, 92.91
1o8x_A 146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 92.84
3dwv_A 187 Glutathione peroxidase-like protein; alpha beta, 3 92.81
3kij_A 180 Probable glutathione peroxidase 8; human PDI-perox 92.72
1o73_A 144 Tryparedoxin; electron transport, trypanosomatid, 92.63
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 92.51
2k6v_A 172 Putative cytochrome C oxidase assembly protein; th 92.44
2lrn_A 152 Thiol:disulfide interchange protein; structural ge 92.36
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 92.18
3hcz_A 148 Possible thiol-disulfide isomerase; APC61559.2, cy 92.18
2h30_A 164 Thioredoxin, peptide methionine sulfoxide reductas 91.99
3lwa_A 183 Secreted thiol-disulfide isomerase; thioredoxin, P 91.94
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 91.94
3fkf_A 148 Thiol-disulfide oxidoreductase; structural genomic 91.92
3ha9_A 165 Uncharacterized thioredoxin-like protein; PSI, MCS 91.62
2obi_A 183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 91.6
2lrt_A 152 Uncharacterized protein; structural genomics, thio 91.6
1xzo_A 174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 91.59
2p31_A 181 CL683, glutathione peroxidase 7; thioredoxin fold, 91.52
2f9s_A 151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 91.44
2rli_A 171 SCO2 protein homolog, mitochondrial; copper protei 91.43
3or5_A 165 Thiol:disulfide interchange protein, thioredoxin p 91.3
3kcm_A 154 Thioredoxin family protein; SGX, thioredoxin prote 91.14
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 91.09
3gl3_A 152 Putative thiol:disulfide interchange protein DSBE; 90.95
2cvb_A 188 Probable thiol-disulfide isomerase/thioredoxin; re 90.86
2b5x_A 148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 90.73
2l5o_A 153 Putative thioredoxin; structural genomics, unknown 90.67
2vup_A 190 Glutathione peroxidase-like protein; oxidoreductas 90.62
2l57_A126 Uncharacterized protein; structural genomics, unkn 90.59
2f8a_A 208 Glutathione peroxidase 1; thioredoxin fold, struct 90.57
3hdc_A 158 Thioredoxin family protein; ATCC53774, DSM 7210, , 90.56
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 90.32
1jfu_A 186 Thiol:disulfide interchange protein TLPA; thioredo 90.29
3kh7_A 176 Thiol:disulfide interchange protein DSBE; TRX-like 90.21
2ls5_A 159 Uncharacterized protein; structural genomics, unkn 89.44
2jsy_A 167 Probable thiol peroxidase; solution structure, ant 89.45
2gs3_A 185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 89.05
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 89.03
1kng_A 156 Thiol:disulfide interchange protein CYCY; thioredo 88.69
2lja_A 152 Putative thiol-disulfide oxidoreductase; structura 88.64
2b1k_A 168 Thiol:disulfide interchange protein DSBE; C-termin 88.35
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 87.69
3ia1_A 154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 87.45
1xvq_A 175 Thiol peroxidase; thioredoxin fold, structural gen 86.7
2r37_A 207 Glutathione peroxidase 3; plasma, structural genom 85.91
2hls_A 243 Protein disulfide oxidoreductase; thioredoxin fold 85.81
2i3y_A 215 Epididymal secretory glutathione peroxidase; thior 85.56
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 85.4
2b7k_A 200 SCO1 protein; metallochaperone, cytochrome C oxida 85.37
4hde_A 170 SCO1/SENC family lipoprotein; structural genomics, 84.73
2bmx_A 195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 84.68
1xvw_A 160 Hypothetical protein RV2238C/MT2298; thioredoxin f 84.37
1we0_A 187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 84.09
1zof_A 198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 84.05
2ywi_A 196 Hypothetical conserved protein; uncharacterized co 83.99
3me7_A 170 Putative uncharacterized protein; electron transfe 83.76
2lus_A 143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 84.21
2h01_A 192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 83.29
1qmv_A 197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 83.25
3u5r_E 218 Uncharacterized protein; structural genomics, PSI- 82.68
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 82.43
1uul_A 202 Tryparedoxin peroxidase homologue; peroxiredoxin, 82.28
3ztl_A 222 Thioredoxin peroxidase; oxidoreductase, reductase, 81.28
3drn_A 161 Peroxiredoxin, bacterioferritin comigratory prote 81.16
4g2e_A 157 Peroxiredoxin; redox protein, structural genomics, 80.62
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
Probab=97.95  E-value=5.3e-06  Score=61.51  Aligned_cols=29  Identities=3%  Similarity=0.032  Sum_probs=25.8

Q ss_pred             eee-cChhhHHHHHHhcCCcEEEEEeeeeC
Q 033947           80 VTE-VNKDTFWPIVKAAGDKTVVLDMYTQW  108 (108)
Q Consensus        80 V~e-~dkddF~~~Lk~AGDKLVVVDF~AtW  108 (108)
                      |.+ .++++|++++.+.++|||||||+|+|
T Consensus        23 v~~l~t~~~f~~~v~~~~~k~VVVdF~A~W   52 (160)
T 2av4_A           23 LQHLNSGWAVDQAIVNEDERLVCIRFGHDY   52 (160)
T ss_dssp             CEECCSHHHHHHHHHHCSSSEEEEEEECTT
T ss_pred             hhccCCHHHHHHHHHhcCCCEEEEEEECCC
Confidence            555 78999999987779999999999999
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A* Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 108
d1f9ma_112 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 2e-11
d2ifqa1105 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapien 7e-04
d1dbya_107 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 0.001
d1gh2a_107 c.47.1.1 (A:) Thioredoxin-like protein, N-terminal 0.002
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin
species: Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]

 Score = 53.6 bits (128), Expect = 2e-11
 Identities = 30/34 (88%), Positives = 32/34 (94%)

Query: 75  ATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW 108
           A VG+VTEVNKDTFWPIVKAAGDK VVLDM+TQW
Sbjct: 3   AIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQW 36
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.68
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 98.14
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 97.9
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 97.15
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.05
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 97.03
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 96.85
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.68
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 96.54
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 96.46
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 96.41
d1o73a_ 144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 94.09
d1i5ga_ 144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 93.8
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 93.54
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 93.41
d1knga_ 144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 93.3
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 92.69
d2b5xa1 143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 92.63
d2cvba1 187 Probable thiol-disulfide isomerase/thioredoxin TTH 92.29
d1o8xa_ 144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 92.21
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 91.88
d1z6na1 166 Hypothetical protein PA1234 {Pseudomonas aeruginos 89.41
d1jfua_ 176 Membrane-anchored thioredoxin-like protein TlpA, s 87.64
d1st9a_ 137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 82.51
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin
species: Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]

Probab=98.68  E-value=4.7e-09  Score=68.04  Aligned_cols=34  Identities=88%  Similarity=1.402  Sum_probs=32.4

Q ss_pred             eeeceeeecChhhHHHHHHhcCCcEEEEEeeeeC
Q 033947           75 ATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQW  108 (108)
Q Consensus        75 ~~vg~V~e~dkddF~~~Lk~AGDKLVVVDF~AtW  108 (108)
                      +.+|+|++++.|+|++.|+++|+|+|||+|||+|
T Consensus         3 ~~~g~v~~~~~d~f~~~l~~~~~k~vvv~f~a~w   36 (112)
T d1f9ma_           3 AIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQW   36 (112)
T ss_dssp             CCTTSEEEECTTTHHHHHHTCTTSCEEEEEECTT
T ss_pred             ccceeeEEeCHHHHHHHHHHcCCCEEEEEEEcCC
Confidence            5679999999999999999999999999999999
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure