Citrus Sinensis ID: 033951


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MTAGSLLHTIWASSTSLTGQQINTGIYPDMTNLSLILLRIQALSWVCLMVVVGRVVLAPMTRCRALNGIPGPALATYYQQRSTPGGFLISEGTAVSPTAPGYFRNSI
ccccHHHHHHHHcccccccccccccccccccHHHHHHHcccccccccccccccEEEEccccccccccccccHHHHHHHHHccccccEEEEEcccccccccccccccc
*****L***IWASSTSLTGQQINTGIYPDMTNLSLILLRIQALSWVCLMVVVGRVVLAPMTRCRALNGIPGPALATYYQQRSTPGGFLISEGTAVSPTAPGYFRN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAGSLLHTIWASSTSLTGQQINTGIYPDMTNLSLILLRIQALSWVCLMVVVGRVVLAPMTRCRALNGIPGPALATYYQQRSTPGGFLISEGTAVSPTAPGYFRNSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
12-oxophytodienoate reductase 3 Specifically cleaves olefinic bonds in cyclic enones. Involved in the biosynthesis of jasmonic acid (JA) and perhaps in biosynthesis or metabolism of other oxylipin signaling moleclules. Required for the spatial and temporal regulation of JA levels during dehiscence of anthers, promoting the stomium degeneration program. In vitro, reduces 9S,13S-12-oxophytodienoic acid (9S,13S-OPDA) and 9R,13R-OPDA to 9S,13S-OPC-8:0 and 9R,13R-OPC-8:0, respectively. Can detoxify the explosive 2,4,6-trinitrotoluene (TNT) in vitro by catalyzing its nitroreduction to form hydroxylamino-dinitrotoluene (HADNT).probableQ9FUP0
12-oxophytodienoate reductase 7 Involved in the biosynthesis of jasmonic acid (JA) and perhaps in biosynthesis or metabolism of other oxylipin signaling moleclules. May be required for the spatial and temporal regulation of JA levels during dehiscence of anthers, promoting the stomium degeneration program. In vitro, reduces cis(+)-12-oxophytodienoic acid (cis(+)-OPDA) and cis(-)-OPDA to cis(+)-OPC-8:0 and cis(-)-OPC-8:0, respectively.probableQ6Z965

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ICP, chain A
Confidence level:very confident
Coverage over the Query: 29-105
View the alignment between query and template
View the model in PyMOL