Citrus Sinensis ID: 033992


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MASIAMSCSAAVPGFRFNKSPMAAGVVTARPRRVVVVRAEGQGINLDIRKTEEKVVDSVVVTELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ
cccccccccccccccECccccccCEEEEEEEEEEEEEcccccccccccccccccEEEEEEccccccccEEEEEEcccccccccccccHHHHHccccccccEEEEcc
**********AVPGFRFNKSPMAAGVVTARPRRVVVVRAEGQGINLDIRKTEEKVVDSVVVTELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIAMSCSAAVPGFRFNKSPMAAGVVTARPRRVVVVRAEGQGINLDIRKTEEKVVDSVVVTELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CDGSH iron-sulfur domain-containing protein 2 Regulator of autophagy that contributes to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy. Contributes to BIK-initiated autophagy, while it is not involved in BIK-dependent activation of caspases. Involved in life span control, probably via its function as regulator of autophagy.probableQ05B71
CDGSH iron-sulfur domain-containing protein 2 Regulator of autophagy that contributes to antagonize becn1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of bcl2 with becn1 and is required for bcl2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy.probableQ5I027
CDGSH iron-sulfur domain-containing protein 2 Regulator of autophagy that contributes to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy. Contributes to BIK-initiated autophagy, while it is not involved in BIK-dependent activation of caspases. Involved in life span control, probably via its function as regulator of autophagy.probableQ9CQB5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S2R, chain A
Confidence level:very confident
Coverage over the Query: 43-106
View the alignment between query and template
View the model in PyMOL