Citrus Sinensis ID: 034008


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MQSDRSDSRGLNTQRTQSLTGSGDTRGKHRIQAELKRLEQETRFLEEELEQLDKTEKASAACNETLRNVEAIPDPLLPITNGPLNPLWDRWFERPKESRGCRCWIL
cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccccHHHHHcccccccccccccc
******************************IQAELKRLEQETRFLEEEL*******K*SAACNETLRNVEAIPDPLLPITNGPLNPLWDRWFERPKESRGCRCWIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSDRSDSRGLNTQRTQSLTGSGDTRGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRNVEAIPDPLLPITNGPLNPLWDRWFERPKESRGCRCWIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Guanine nucleotide-binding protein subunit gamma 2 Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Involved in the abscisic acid (ABA) and ethylene signaling pathways. Regulates basipetal transport of auxin (IAA) in roots and hypocotyls, and thus modulates root architecture (e.g. lateral root formation). The heterotrimeric G-protein controls defense responses to necrotrophic and vascular fungi probably by modulating cell wall-related genes expression; involved in resistance to Plectosphaerella cucumerina.probableQ93V47

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GOT, chain G
Confidence level:confident
Coverage over the Query: 32-87
View the alignment between query and template
View the model in PyMOL