Citrus Sinensis ID: 034010


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MAEFDGRPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLRAYDLKQKWKEGNFILEKFKMLKEYK
ccccccccEEEcccccccccccccEEEccCCcccccEEEEEcccccccccccccEEEEccEEEEEEEccccccEEEEEEcEEccccccEEccEEEEEEccccEEcc
**EFDGRPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLRAYDLKQKWKEGNFILEKFKMLK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEFDGRPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLRAYDLKQKWKEGNFILEKFKMLKEYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein yippee-like At4g27740 probableQ2V3E2
Protein yippee-like CG15309 probableQ9W2X7
Protein yippee-like 1 May play a role in epithelioid conversion of fibroblasts.probableQ9ESC7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EQT, chain A
Confidence level:confident
Coverage over the Query: 7-101
View the alignment between query and template
View the model in PyMOL