Citrus Sinensis ID: 034056

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MAMVASDNAPLLAEVDMGTDSSASTVRATVVQASTIFNDTPATLDKAERLLAEASGYGSQVVVFPEAFIGGYPRGTNFGVSIANRTAKGKEDFRKYHASAIDVPG
cccccccccccccHHccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccHHHHHHHHHccccccc
*************************VRATVVQASTIFNDTPATLDKAERLLAEASGYGSQVVVFPEAFIGGYPRGTNFGVSIANRTAKGKEDFRKYHASAIDVPG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMVASDNAPLLAEVDMGTDSSASTVRATVVQASTIFNDTPATLDKAERLLAEASGYGSQVVVFPEAFIGGYPRGTNFGVSIANRTAKGKEDFRKYHASAIDVPG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bifunctional nitrilase/nitrile hydratase NIT4 Highly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN) or allylcyanide and no acitvity with indole-3-acetonitrile. Not associated with auxin production but may be involved in cyanide detoxification.probableP46011

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HKX, chain A
Confidence level:very confident
Coverage over the Query: 22-75
View the alignment between query and template
View the model in PyMOL