Citrus Sinensis ID: 034069


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFPAD
ccccccccccccccccccCEEEEccccccccEEEEccEEEEEEEEEEccccccccCEEEEEEEEcccccEEEEEEcccccEEEcCEEccEEEEEEEcccccccc
******************TFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFPAD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 5A-1 The precise role of eIF-5A in protein biosynthesis is not known but it functions by promoting the formation of the first peptide bond.confidentQ9XI91
Eukaryotic translation initiation factor 5A-1 The precise role of eIF-5A in protein biosynthesis is not known but it functions by promoting the formation of the first peptide bond.probableP69039
Eukaryotic translation initiation factor 5A The precise role of eIF-5A in protein biosynthesis is not known but it functions by promoting the formation of the first peptide bond.probableQ9SC12

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HKS, chain A
Confidence level:very confident
Coverage over the Query: 17-101
View the alignment between query and template
View the model in PyMOL