Citrus Sinensis ID: 034096
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 104 | ||||||
| 297604251 | 105 | Os05g0314100 [Oryza sativa Japonica Grou | 0.711 | 0.704 | 0.986 | 1e-35 | |
| 212722184 | 105 | uncharacterized protein LOC100193106 [Ze | 0.711 | 0.704 | 0.986 | 1e-35 | |
| 226506222 | 104 | LOC100280773 [Zea mays] gi|195607934|gb| | 0.711 | 0.711 | 0.986 | 1e-35 | |
| 413918936 | 104 | hypothetical protein ZEAMMB73_850141 [Ze | 0.711 | 0.711 | 0.986 | 1e-35 | |
| 326493364 | 107 | predicted protein [Hordeum vulgare subsp | 0.711 | 0.691 | 0.986 | 1e-35 | |
| 212720721 | 105 | uncharacterized protein LOC100193568 [Ze | 0.711 | 0.704 | 0.986 | 1e-35 | |
| 414586344 | 102 | TPA: hypothetical protein ZEAMMB73_87910 | 0.711 | 0.725 | 0.986 | 2e-35 | |
| 192910682 | 105 | small nuclear ribonucleoprotein-like pro | 0.711 | 0.704 | 0.986 | 2e-35 | |
| 57900175 | 431 | putative small nuclear ribonucleoprotein | 0.721 | 0.174 | 0.933 | 2e-35 | |
| 255573198 | 103 | small nuclear ribonucleoprotein sm d2, p | 0.711 | 0.718 | 0.972 | 3e-35 |
| >gi|297604251|ref|NP_001055168.2| Os05g0314100 [Oryza sativa Japonica Group] gi|54291778|gb|AAV32147.1| putative small nuclear ribonucleoprotein D2 [Oryza sativa Japonica Group] gi|215768148|dbj|BAH00377.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768714|dbj|BAH00943.1| unnamed protein product [Oryza sativa Japonica Group] gi|218196532|gb|EEC78959.1| hypothetical protein OsI_19425 [Oryza sativa Indica Group] gi|222631079|gb|EEE63211.1| hypothetical protein OsJ_18021 [Oryza sativa Japonica Group] gi|255676234|dbj|BAF17082.2| Os05g0314100 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Score = 153 bits (387), Expect = 1e-35, Method: Compositional matrix adjust.
Identities = 73/74 (98%), Positives = 74/74 (100%)
Query: 31 QVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMF 90
QVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKKALPVNKDRFISKMF
Sbjct: 32 QVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKKALPVNKDRFISKMF 91
Query: 91 LRGDSVIIVLRNPK 104
LRGDSVIIVLRNPK
Sbjct: 92 LRGDSVIIVLRNPK 105
|
Source: Oryza sativa Japonica Group Species: Oryza sativa Genus: Oryza Family: Poaceae Order: Poales Class: Liliopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|212722184|ref|NP_001131740.1| uncharacterized protein LOC100193106 [Zea mays] gi|194692396|gb|ACF80282.1| unknown [Zea mays] gi|195629728|gb|ACG36505.1| small nuclear ribonucleoprotein Sm D2 [Zea mays] gi|413918934|gb|AFW58866.1| Small nuclear ribonucleoprotein Sm D2 isoform 1 [Zea mays] gi|413918935|gb|AFW58867.1| Small nuclear ribonucleoprotein Sm D2 isoform 2 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|226506222|ref|NP_001147167.1| LOC100280773 [Zea mays] gi|195607934|gb|ACG25797.1| small nuclear ribonucleoprotein Sm D2 [Zea mays] gi|195622778|gb|ACG33219.1| small nuclear ribonucleoprotein Sm D2 [Zea mays] gi|238013460|gb|ACR37765.1| unknown [Zea mays] gi|413942324|gb|AFW74973.1| Small nuclear ribonucleoprotein Sm D2 isoform 1 [Zea mays] gi|413942325|gb|AFW74974.1| Small nuclear ribonucleoprotein Sm D2 isoform 2 [Zea mays] gi|413942326|gb|AFW74975.1| Small nuclear ribonucleoprotein Sm D2 isoform 3 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|413918936|gb|AFW58868.1| hypothetical protein ZEAMMB73_850141 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|326493364|dbj|BAJ85143.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|212720721|ref|NP_001132149.1| uncharacterized protein LOC100193568 [Zea mays] gi|194693576|gb|ACF80872.1| unknown [Zea mays] gi|414586342|tpg|DAA36913.1| TPA: hypothetical protein ZEAMMB73_879106 [Zea mays] gi|414586343|tpg|DAA36914.1| TPA: hypothetical protein ZEAMMB73_879106 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|414586344|tpg|DAA36915.1| TPA: hypothetical protein ZEAMMB73_879106 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|192910682|gb|ACF06449.1| small nuclear ribonucleoprotein-like protein [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
| >gi|57900175|dbj|BAD88260.1| putative small nuclear ribonucleoprotein [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|255573198|ref|XP_002527528.1| small nuclear ribonucleoprotein sm d2, putative [Ricinus communis] gi|223533078|gb|EEF34837.1| small nuclear ribonucleoprotein sm d2, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 104 | ||||||
| TAIR|locus:2043323 | 109 | AT2G47640 "AT2G47640" [Arabido | 0.711 | 0.678 | 0.959 | 6.5e-35 | |
| TAIR|locus:2081685 | 109 | AT3G62840 "AT3G62840" [Arabido | 0.711 | 0.678 | 0.959 | 6.5e-35 | |
| FB|FBgn0261789 | 119 | SmD2 "Small ribonucleoprotein | 0.701 | 0.613 | 0.917 | 4.1e-33 | |
| UNIPROTKB|G3X6Z3 | 117 | SNRPD2 "Small nuclear ribonucl | 0.701 | 0.623 | 0.890 | 1.4e-32 | |
| UNIPROTKB|Q3SZF8 | 118 | SNRPD2 "Small nuclear ribonucl | 0.701 | 0.618 | 0.890 | 1.4e-32 | |
| UNIPROTKB|F1PSI7 | 118 | SNRPD2 "Uncharacterized protei | 0.701 | 0.618 | 0.890 | 1.4e-32 | |
| UNIPROTKB|P62316 | 118 | SNRPD2 "Small nuclear ribonucl | 0.701 | 0.618 | 0.890 | 1.4e-32 | |
| MGI|MGI:98345 | 118 | Snrpd2 "small nuclear ribonucl | 0.701 | 0.618 | 0.890 | 1.4e-32 | |
| RGD|1593018 | 118 | Snrpd2 "small nuclear ribonucl | 0.701 | 0.618 | 0.890 | 1.4e-32 | |
| ZFIN|ZDB-GENE-040914-10 | 118 | snrpd2 "small nuclear ribonucl | 0.701 | 0.618 | 0.890 | 1.4e-32 |
| TAIR|locus:2043323 AT2G47640 "AT2G47640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 378 (138.1 bits), Expect = 6.5e-35, P = 6.5e-35
Identities = 71/74 (95%), Positives = 74/74 (100%)
Query: 31 QVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMF 90
QVLINCRNN+KLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKKALPVN+DRFISKMF
Sbjct: 36 QVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKKALPVNRDRFISKMF 95
Query: 91 LRGDSVIIVLRNPK 104
LRGDSVIIVLRNPK
Sbjct: 96 LRGDSVIIVLRNPK 109
|
|
| TAIR|locus:2081685 AT3G62840 "AT3G62840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0261789 SmD2 "Small ribonucleoprotein particle protein SmD2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X6Z3 SNRPD2 "Small nuclear ribonucleoprotein Sm D2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SZF8 SNRPD2 "Small nuclear ribonucleoprotein Sm D2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PSI7 SNRPD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62316 SNRPD2 "Small nuclear ribonucleoprotein Sm D2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98345 Snrpd2 "small nuclear ribonucleoprotein D2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1593018 Snrpd2 "small nuclear ribonucleoprotein D2 polypeptide" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040914-10 snrpd2 "small nuclear ribonucleoprotein D2 polypeptide" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 104 | |||
| cd01720 | 89 | cd01720, Sm_D2, Sm protein D2 | 2e-46 | |
| cd01730 | 82 | cd01730, LSm3, Like-Sm protein 3 | 2e-16 | |
| smart00651 | 67 | smart00651, Sm, snRNP Sm proteins | 5e-13 | |
| pfam01423 | 66 | pfam01423, LSM, LSM domain | 2e-11 | |
| COG1958 | 79 | COG1958, LSM1, Small nuclear ribonucleoprotein (sn | 6e-11 | |
| cd01731 | 69 | cd01731, archaeal_Sm1, archaeal Sm protein 1 | 9e-08 | |
| cd00600 | 63 | cd00600, Sm_like, Sm and related proteins | 1e-07 |
| >gnl|CDD|212467 cd01720, Sm_D2, Sm protein D2 | Back alignment and domain information |
|---|
Score = 143 bits (363), Expect = 2e-46
Identities = 65/73 (89%), Positives = 69/73 (94%), Gaps = 1/73 (1%)
Query: 31 QVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMF 90
QVLINCRNNKKLL RV+AFDRHCNMVLENV+EMWTE+PKTGKGKK PVNKDRFISKMF
Sbjct: 18 QVLINCRNNKKLLARVKAFDRHCNMVLENVKEMWTEVPKTGKGKKSK-PVNKDRFISKMF 76
Query: 91 LRGDSVIIVLRNP 103
LRGDSVI+VLRNP
Sbjct: 77 LRGDSVILVLRNP 89
|
The eukaryotic Sm proteins (B/B', D1, D2, D3, E, F and G) assemble into a hetero-heptameric ring around the Sm site of the 2,2,7-trimethyl guanosine (m3G) capped U1, U2, U4 and U5 snRNAs (Sm snRNAs) forming the core of the snRNP particle. The snRNP particle, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit D2 heterodimerizes with subunit D1 and three such heterodimers form a hexameric ring structure with alternating D1 and D2 subunits. The D1 - D2 heterodimer also assembles into a heptameric ring containing D2, D3, E, F, and G subunits. Length = 89 |
| >gnl|CDD|212477 cd01730, LSm3, Like-Sm protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201787 pfam01423, LSM, LSM domain | Back alignment and domain information |
|---|
| >gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| cd01720 | 87 | Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.93 | |
| cd01730 | 82 | LSm3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.92 | |
| cd01732 | 76 | LSm5 The eukaryotic Sm and Sm-like (LSm) proteins | 99.92 | |
| cd01729 | 81 | LSm7 The eukaryotic Sm and Sm-like (LSm) proteins | 99.9 | |
| cd01731 | 68 | archaeal_Sm1 The archaeal sm1 proteins: The Sm pro | 99.89 | |
| cd01728 | 74 | LSm1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.89 | |
| PRK00737 | 72 | small nuclear ribonucleoprotein; Provisional | 99.89 | |
| cd01717 | 79 | Sm_B The eukaryotic Sm and Sm-like (LSm) proteins | 99.89 | |
| cd01719 | 72 | Sm_G The eukaryotic Sm and Sm-like (LSm) proteins | 99.88 | |
| cd01727 | 74 | LSm8 The eukaryotic Sm and Sm-like (LSm) proteins | 99.88 | |
| cd01718 | 79 | Sm_E The eukaryotic Sm and Sm-like (LSm) proteins | 99.86 | |
| cd01726 | 67 | LSm6 The eukaryotic Sm and Sm-like (LSm) proteins | 99.86 | |
| KOG3460 | 91 | consensus Small nuclear ribonucleoprotein (snRNP) | 99.85 | |
| cd01722 | 68 | Sm_F The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd06168 | 75 | LSm9 The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| PF01423 | 67 | LSM: LSM domain ; InterPro: IPR001163 This family | 99.84 | |
| smart00651 | 67 | Sm snRNP Sm proteins. small nuclear ribonucleoprot | 99.84 | |
| COG1958 | 79 | LSM1 Small nuclear ribonucleoprotein (snRNP) homol | 99.83 | |
| PTZ00138 | 89 | small nuclear ribonucleoprotein; Provisional | 99.79 | |
| cd00600 | 63 | Sm_like The eukaryotic Sm and Sm-like (LSm) protei | 99.78 | |
| cd01723 | 76 | LSm4 The eukaryotic Sm and Sm-like (LSm) proteins | 99.78 | |
| KOG1780 | 77 | consensus Small Nuclear ribonucleoprotein G [RNA p | 99.78 | |
| cd01721 | 70 | Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.76 | |
| cd01725 | 81 | LSm2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.74 | |
| cd01724 | 90 | Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.73 | |
| KOG1781 | 108 | consensus Small Nuclear ribonucleoprotein splicing | 99.72 | |
| cd01733 | 78 | LSm10 The eukaryotic Sm and Sm-like (LSm) proteins | 99.72 | |
| KOG1783 | 77 | consensus Small nuclear ribonucleoprotein F [RNA p | 99.57 | |
| KOG1782 | 129 | consensus Small Nuclear ribonucleoprotein splicing | 99.56 | |
| KOG3482 | 79 | consensus Small nuclear ribonucleoprotein (snRNP) | 99.54 | |
| KOG3168 | 177 | consensus U1 snRNP component [Transcription] | 99.53 | |
| KOG1784 | 96 | consensus Small Nuclear ribonucleoprotein splicing | 99.52 | |
| KOG3459 | 114 | consensus Small nuclear ribonucleoprotein (snRNP) | 99.44 | |
| KOG1775 | 84 | consensus U6 snRNA-associated Sm-like protein [RNA | 99.43 | |
| KOG1774 | 88 | consensus Small nuclear ribonucleoprotein E [RNA p | 99.38 | |
| KOG3448 | 96 | consensus Predicted snRNP core protein [RNA proces | 99.21 | |
| cd01739 | 66 | LSm11_C The eukaryotic Sm and Sm-like (LSm) protei | 99.02 | |
| KOG3293 | 134 | consensus Small nuclear ribonucleoprotein (snRNP) | 98.9 | |
| KOG3428 | 109 | consensus Small nuclear ribonucleoprotein SMD1 and | 98.26 | |
| KOG3172 | 119 | consensus Small nuclear ribonucleoprotein Sm D3 [R | 98.18 | |
| PF14438 | 77 | SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. | 97.64 | |
| cd01716 | 61 | Hfq Hfq, an abundant, ubiquitous RNA-binding prote | 96.71 | |
| TIGR02383 | 61 | Hfq RNA chaperone Hfq. This model represents the R | 96.57 | |
| PF02237 | 48 | BPL_C: Biotin protein ligase C terminal domain; In | 96.12 | |
| COG1923 | 77 | Hfq Uncharacterized host factor I protein [General | 95.4 | |
| PRK00395 | 79 | hfq RNA-binding protein Hfq; Provisional | 95.12 | |
| PF12701 | 96 | LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC | 94.85 | |
| PF11095 | 80 | Gemin7: Gem-associated protein 7 (Gemin7); InterPr | 93.46 | |
| cd01735 | 61 | LSm12_N LSm12 belongs to a family of Sm-like prote | 93.36 | |
| PRK14638 | 150 | hypothetical protein; Provisional | 93.08 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 93.03 | |
| cd01736 | 74 | LSm14_N LSm14 (also known as RAP55) belongs to a f | 92.4 | |
| PRK14639 | 140 | hypothetical protein; Provisional | 91.84 | |
| PRK02001 | 152 | hypothetical protein; Validated | 91.53 | |
| PRK14644 | 136 | hypothetical protein; Provisional | 90.96 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 90.21 | |
| PF06372 | 166 | Gemin6: Gemin6 protein; InterPro: IPR009422 This f | 88.83 | |
| cd01734 | 83 | YlxS_C YxlS is a Bacillus subtilis gene of unknown | 88.02 | |
| PRK14640 | 152 | hypothetical protein; Provisional | 87.64 | |
| PRK14633 | 150 | hypothetical protein; Provisional | 87.19 | |
| PRK14642 | 197 | hypothetical protein; Provisional | 86.33 | |
| PRK14636 | 176 | hypothetical protein; Provisional | 85.75 | |
| PRK14645 | 154 | hypothetical protein; Provisional | 85.14 | |
| PF10842 | 66 | DUF2642: Protein of unknown function (DUF2642); In | 85.11 | |
| PF02576 | 141 | DUF150: Uncharacterised BCR, YhbC family COG0779; | 84.94 | |
| PRK14643 | 164 | hypothetical protein; Provisional | 84.27 | |
| COG0779 | 153 | Uncharacterized protein conserved in bacteria [Fun | 84.16 | |
| PRK00092 | 154 | ribosome maturation protein RimP; Reviewed | 83.2 | |
| PRK14634 | 155 | hypothetical protein; Provisional | 82.99 | |
| PRK14632 | 172 | hypothetical protein; Provisional | 82.79 | |
| PRK14646 | 155 | hypothetical protein; Provisional | 82.51 | |
| PRK14647 | 159 | hypothetical protein; Provisional | 81.31 | |
| PRK14637 | 151 | hypothetical protein; Provisional | 80.57 | |
| PF03614 | 165 | Flag1_repress: Repressor of phase-1 flagellin; Int | 80.35 |
| >cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
Probab=99.93 E-value=3.3e-25 Score=145.61 Aligned_cols=82 Identities=82% Similarity=1.249 Sum_probs=66.2
Q ss_pred HHHHHhcC--CcEEEEEEcCCeEEEEEEEEecCccceEeeceEEeeecCCCCCCCcccccccceeeeeCeEEEeCCcEEE
Q 034096 21 CFWALEFI--VLQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVII 98 (104)
Q Consensus 21 ~~~L~~~l--~krV~V~l~~gr~i~G~L~~fD~~mNLvL~d~~E~~~~~~~~~~~~~~~~~~~~~r~lg~~~IRGdnVv~ 98 (104)
+.+|.+.+ +++|.|+|++||++.|+|+|||+||||+|+||+|.+...++++++. +..+..+++++|.+|||||||++
T Consensus 4 l~~L~~~~~~~~~V~V~lr~~r~~~G~L~~fD~hmNlvL~d~~E~~~~~~k~~~~~-~~~~~~~~r~lg~v~iRGd~Vv~ 82 (87)
T cd01720 4 LSLLTQAVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKTGKGK-KAKPVNKDRFISKMFLRGDSVIL 82 (87)
T ss_pred HHHHHHHHcCCCEEEEEEcCCCEEEEEEEEecCccEEEEcceEEEeeccccccccc-cccceeeeeEcccEEEeCCEEEE
Confidence 45677776 8999999999999999999999999999999999987644332211 11123456889999999999999
Q ss_pred EEecC
Q 034096 99 VLRNP 103 (104)
Q Consensus 99 Is~~~ 103 (104)
|+++|
T Consensus 83 Is~~~ 87 (87)
T cd01720 83 VLRNP 87 (87)
T ss_pred EecCC
Confidence 99986
|
Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit D2 heterodimerizes with subunit D1 and three such heterodimers form a hexameric ring structure with alternating D1 and D2 subunits. The D1 - D2 heterodimer also assembles into a heptameric ring containing D2, D3, E, F, and G subunits. Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes. |
| >cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences | Back alignment and domain information |
|---|
| >cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PRK00737 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3460 consensus Small nuclear ribonucleoprotein (snRNP) LSM3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins | Back alignment and domain information |
|---|
| >smart00651 Sm snRNP Sm proteins | Back alignment and domain information |
|---|
| >COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >PTZ00138 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1780 consensus Small Nuclear ribonucleoprotein G [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1781 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1783 consensus Small nuclear ribonucleoprotein F [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1782 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3482 consensus Small nuclear ribonucleoprotein (snRNP) SMF [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3168 consensus U1 snRNP component [Transcription] | Back alignment and domain information |
|---|
| >KOG1784 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3459 consensus Small nuclear ribonucleoprotein (snRNP) Sm core protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1775 consensus U6 snRNA-associated Sm-like protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1774 consensus Small nuclear ribonucleoprotein E [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3448 consensus Predicted snRNP core protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3293 consensus Small nuclear ribonucleoprotein (snRNP) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3428 consensus Small nuclear ribonucleoprotein SMD1 and related snRNPs [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3172 consensus Small nuclear ribonucleoprotein Sm D3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 | Back alignment and domain information |
|---|
| >cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others | Back alignment and domain information |
|---|
| >TIGR02383 Hfq RNA chaperone Hfq | Back alignment and domain information |
|---|
| >PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown | Back alignment and domain information |
|---|
| >COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00395 hfq RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A | Back alignment and domain information |
|---|
| >PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins | Back alignment and domain information |
|---|
| >cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PRK14638 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PRK14639 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02001 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14644 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins | Back alignment and domain information |
|---|
| >cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold | Back alignment and domain information |
|---|
| >PRK14640 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14642 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14636 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14645 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >PF02576 DUF150: Uncharacterised BCR, YhbC family COG0779; InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [] | Back alignment and domain information |
|---|
| >PRK14643 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0779 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK00092 ribosome maturation protein RimP; Reviewed | Back alignment and domain information |
|---|
| >PRK14634 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14632 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14646 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14647 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14637 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03614 Flag1_repress: Repressor of phase-1 flagellin; InterPro: IPR003223 Flagellin is the subunit which polymerises to form the filaments of bacterial flagella | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 104 | ||||
| 1b34_B | 118 | Crystal Structure Of The D1d2 Sub-Complex From The | 8e-27 | ||
| 4emg_A | 93 | Crystal Structure Of Splsm3 Length = 93 | 2e-06 | ||
| 1th7_A | 81 | Crystal Structure Of An Archaeal Sm Protein From Su | 7e-05 | ||
| 3bw1_A | 96 | Crystal Structure Of Homomeric Yeast Lsm3 Exhibitin | 7e-04 |
| >pdb|1B34|B Chain B, Crystal Structure Of The D1d2 Sub-Complex From The Human Snrnp Core Domain Length = 118 | Back alignment and structure |
|
| >pdb|4EMG|A Chain A, Crystal Structure Of Splsm3 Length = 93 | Back alignment and structure |
| >pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From Sulfolobus Solfataricus Length = 81 | Back alignment and structure |
| >pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting Novel Octameric Ring Organisation Length = 96 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 104 | |||
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 2e-31 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 3e-23 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 4e-20 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 4e-18 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 5e-09 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 6e-09 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 2e-08 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 5e-08 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 6e-08 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 8e-08 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 1e-07 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 2e-07 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 3e-06 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 7e-06 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 3e-05 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 5e-05 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 1e-04 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 3e-04 |
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Length = 118 | Back alignment and structure |
|---|
Score = 106 bits (265), Expect = 2e-31
Identities = 65/73 (89%), Positives = 72/73 (98%)
Query: 31 QVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMF 90
QVLINCRNNKKLLGRV+AFDRHCNMVLENV+EMWTE+PK+GKGKKK+ PVNKDR+ISKMF
Sbjct: 41 QVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMF 100
Query: 91 LRGDSVIIVLRNP 103
LRGDSVI+VLRNP
Sbjct: 101 LRGDSVIVVLRNP 113
|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 | Back alignment and structure |
|---|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 99.91 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 99.91 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 99.91 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 99.9 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 99.89 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 99.89 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 99.89 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 99.89 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 99.89 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 99.89 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 99.89 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 99.89 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 99.89 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 99.88 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 99.88 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 99.88 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 99.88 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 99.88 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 99.87 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.86 | |
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 99.85 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 99.84 | |
| 1m5q_A | 130 | SMAP3, small nuclear ribonucleoprotein homolog, SM | 99.8 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 99.8 | |
| 1y96_A | 86 | Gemin6, SIP2, GEM-associated protein 6; SM fold, p | 98.44 | |
| 1kq1_A | 77 | HFQ, HOST factor for Q beta; hexamer, RNA binding | 97.01 | |
| 2ylb_A | 74 | Protein HFQ; RNA-binding protein, LSM protein, RNA | 97.0 | |
| 2qtx_A | 71 | Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi | 96.93 | |
| 3ahu_A | 78 | Protein HFQ; SM-like motif, protein-RNA complex, t | 96.92 | |
| 1u1s_A | 82 | HFQ protein; SM-like bacterial protein, riken stru | 96.84 | |
| 2y90_A | 104 | Protein HFQ; RNA-binding protein, SM-like, RNA cha | 96.78 | |
| 3sb2_A | 79 | Protein HFQ; SM-like, RNA chaperone, chaperone; 2. | 96.77 | |
| 3hfo_A | 70 | SSR3341 protein; HFQ, SM, RNA-binding protein, sRN | 96.38 | |
| 3hfn_A | 72 | ASL2047 protein; HFQ, SM, RNA-binding protein, sRN | 95.92 | |
| 1ycy_A | 71 | Conserved hypothetical protein; structural genomic | 94.4 | |
| 1y96_B | 85 | Gemin7, SIP3, GEM-associated protein 7; SM fold, p | 92.6 | |
| 4a53_A | 125 | EDC3; RNA binding protein; NMR {Schizosaccharomyce | 91.39 | |
| 3rux_A | 270 | BIRA bifunctional protein; biotin-protein ligase, | 86.64 | |
| 1ib8_A | 164 | Conserved protein SP14.3; nucleic acid binding pro | 86.43 | |
| 2fb7_A | 95 | SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 | 85.16 | |
| 2vxe_A | 88 | CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA | 83.8 | |
| 2vc8_A | 84 | Enhancer of mRNA-decapping protein 3; P-BODY compo | 81.72 |
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
Probab=99.91 E-value=2.4e-24 Score=141.70 Aligned_cols=88 Identities=25% Similarity=0.314 Sum_probs=65.1
Q ss_pred eehhhHHHHHHhcCCcEEEEEEcCCeEEEEEEEEecCccceEeeceEEeeecCCCCCCCcccccccceeeeeCeEEEeCC
Q 034096 15 TTLMLFCFWALEFIVLQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGD 94 (104)
Q Consensus 15 ~~~~l~~~~L~~~l~krV~V~l~~gr~i~G~L~~fD~~mNLvL~d~~E~~~~~~~~~~~~~~~~~~~~~r~lg~~~IRGd 94 (104)
.++..+..+|+..++++|.|+|++||++.|+|+|||+||||+|+||+|++...+++++..+ ......++.+|+++|||+
T Consensus 5 ~~~~~Pl~lL~~~~~~~V~V~l~~gr~~~G~L~~~D~~mNlvL~d~~E~~~~~~~~~~~~~-~~~~~~~r~lG~v~iRG~ 83 (93)
T 4emg_A 5 QAVAEPLDLVRLSLDEIVYVKLRGDRELNGRLHAYDEHLNMVLGDAEEIVTIFDDEETDKD-KALKTIRKHYEMLFVRGD 83 (93)
T ss_dssp ----CTTHHHHTTTTSEEEEEETTTEEEEEEEEEECTTCCEEEEEEEEEEC---------------CEEEEEEEEEECGG
T ss_pred cccCCCHHHHHHhCCCEEEEEECCCcEEEEEEEEECCcccEEeecEEEEEeccccCCcccc-ccccccEeEeceEEECCC
Confidence 3445667889999999999999999999999999999999999999999875443322100 001124688999999999
Q ss_pred cEEEEEecC
Q 034096 95 SVIIVLRNP 103 (104)
Q Consensus 95 nVv~Is~~~ 103 (104)
||++|+|+.
T Consensus 84 nVv~I~p~~ 92 (93)
T 4emg_A 84 SVILIAPPR 92 (93)
T ss_dssp GEEEEECCC
T ss_pred eEEEEEecC
Confidence 999999864
|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A | Back alignment and structure |
|---|
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D | Back alignment and structure |
|---|
| >1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A | Back alignment and structure |
|---|
| >2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* | Back alignment and structure |
|---|
| >2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A | Back alignment and structure |
|---|
| >1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A | Back alignment and structure |
|---|
| >2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A | Back alignment and structure |
|---|
| >3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 | Back alignment and structure |
|---|
| >3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} | Back alignment and structure |
|---|
| >3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} | Back alignment and structure |
|---|
| >1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 | Back alignment and structure |
|---|
| >1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A | Back alignment and structure |
|---|
| >3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A | Back alignment and structure |
|---|
| >1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 | Back alignment and structure |
|---|
| >2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A | Back alignment and structure |
|---|
| >2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 104 | ||||
| d1b34b_ | 93 | b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s | 6e-28 | |
| d2fwka1 | 92 | b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr | 1e-17 | |
| d1d3bb_ | 81 | b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa | 1e-14 | |
| d1h641_ | 71 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 7e-11 | |
| d1i8fa_ | 71 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 2e-10 | |
| d1th7a1 | 76 | b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote | 7e-10 | |
| d1i4k1_ | 72 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 2e-09 | |
| d1mgqa_ | 74 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 3e-09 | |
| d1ljoa_ | 75 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 1e-05 | |
| d1d3ba_ | 72 | b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s | 3e-04 | |
| d1m5q1_ | 127 | b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch | 4e-04 | |
| d1n9ra_ | 68 | b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S | 7e-04 |
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: D2 core SNRNP protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 95.3 bits (237), Expect = 6e-28
Identities = 65/74 (87%), Positives = 72/74 (97%)
Query: 31 QVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMF 90
QVLINCRNNKKLLGRV+AFDRHCNMVLENV+EMWTE+PK+GKGKKK+ PVNKDR+ISKMF
Sbjct: 16 QVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMF 75
Query: 91 LRGDSVIIVLRNPK 104
LRGDSVI+VLRNP
Sbjct: 76 LRGDSVIVVLRNPL 89
|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| d1b34b_ | 93 | D2 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.94 | |
| d2fwka1 | 92 | U6 snRNA-associated sm-like protein LSM5 {Cryptosp | 99.93 | |
| d1d3bb_ | 81 | B core SNRNP protein {Human (Homo sapiens) [TaxId: | 99.91 | |
| d1i8fa_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyrob | 99.91 | |
| d1h641_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyroc | 99.89 | |
| d1i4k1_ | 72 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.89 | |
| d1mgqa_ | 74 | Archaeal homoheptameric Sm protein {Archaeon Metha | 99.89 | |
| d1ljoa_ | 75 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.89 | |
| d1th7a1 | 76 | Archaeal homoheptameric Sm protein {Sulfolobus sol | 99.88 | |
| d1n9ra_ | 68 | Small nuclear ribonucleoprotein F, Smf {Baker's ye | 99.88 | |
| d1d3ba_ | 72 | D3 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.81 | |
| d1b34a_ | 80 | D1 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.73 | |
| d1m5q1_ | 127 | Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul | 99.67 | |
| d1u1sa1 | 66 | Pleiotropic translational regulator Hfq {Pseudomon | 96.39 | |
| d1biaa2 | 47 | Biotin repressor/biotin holoenzyme synthetase, C-t | 95.48 | |
| d1kq1a_ | 60 | Pleiotropic translational regulator Hfq {Staphyloc | 95.32 | |
| d1ycya1 | 66 | Hypothetical protein PF1955 {Pyrococcus furiosus [ | 94.35 | |
| d1ib8a1 | 74 | Hypothetical protein SP14.3 (SP0552) {Streptococcu | 91.35 | |
| d2vxfa1 | 80 | LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) | 89.46 |
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: D2 core SNRNP protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94 E-value=6.1e-27 Score=152.68 Aligned_cols=82 Identities=79% Similarity=1.245 Sum_probs=58.0
Q ss_pred HHHhcC--CcEEEEEEcCCeEEEEEEEEecCccceEeeceEEeeecCCCCCCCcccccccceeeeeCeEEEeCCcEEEEE
Q 034096 23 WALEFI--VLQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVL 100 (104)
Q Consensus 23 ~L~~~l--~krV~V~l~~gr~i~G~L~~fD~~mNLvL~d~~E~~~~~~~~~~~~~~~~~~~~~r~lg~~~IRGdnVv~Is 100 (104)
.|.+.+ ++||+|.+++||++.|+|+|||+||||+|+||+|.+...++..+..+..+...++|++|+++||||||++|.
T Consensus 6 ~l~~~~~~~~rV~V~lr~~r~~~G~L~afD~~~NlVL~d~~E~~~~~~~~~~~~~~~~~~~~~R~lg~~liRGdnVv~I~ 85 (93)
T d1b34b_ 6 VLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVL 85 (93)
T ss_dssp HHHHHHHHTCEEEEEETTSCEEEEEEEEECTTCCEEEEEEEEC-------------------CEEEEEEEECGGGEEEEE
T ss_pred HHHHHHhCCcEEEEEECCCCEEEEEEEEeccceeEEeeceEEEEEecCCccccccccccceeEEEeceEEEeCCEEEEEE
Confidence 344444 789999999999999999999999999999999998765443322222233446789999999999999999
Q ss_pred ecCC
Q 034096 101 RNPK 104 (104)
Q Consensus 101 ~~~~ 104 (104)
++|.
T Consensus 86 ~~p~ 89 (93)
T d1b34b_ 86 RNPL 89 (93)
T ss_dssp ECCC
T ss_pred cChh
Confidence 9984
|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|