Citrus Sinensis ID: 034106
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| 225454716 | 460 | PREDICTED: V-type proton ATPase subunit | 1.0 | 0.223 | 0.912 | 5e-51 | |
| 297737281 | 483 | unnamed protein product [Vitis vinifera] | 1.0 | 0.213 | 0.912 | 7e-51 | |
| 224124112 | 452 | predicted protein [Populus trichocarpa] | 0.990 | 0.225 | 0.911 | 1e-49 | |
| 388494890 | 429 | unknown [Lotus japonicus] | 1.0 | 0.240 | 0.883 | 8e-49 | |
| 224145903 | 447 | predicted protein [Populus trichocarpa] | 0.990 | 0.228 | 0.892 | 9e-49 | |
| 255558087 | 446 | vacuolar ATP synthase subunit h, putativ | 1.0 | 0.230 | 0.883 | 1e-48 | |
| 356498440 | 452 | PREDICTED: V-type proton ATPase subunit | 0.990 | 0.225 | 0.882 | 2e-48 | |
| 357518453 | 448 | V-type proton ATPase subunit H [Medicago | 0.990 | 0.227 | 0.872 | 5e-48 | |
| 217073296 | 452 | unknown [Medicago truncatula] gi|3884915 | 0.990 | 0.225 | 0.872 | 6e-48 | |
| 356559428 | 452 | PREDICTED: V-type proton ATPase subunit | 0.990 | 0.225 | 0.862 | 4e-47 |
| >gi|225454716|ref|XP_002271887.1| PREDICTED: V-type proton ATPase subunit H-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 204 bits (519), Expect = 5e-51, Method: Compositional matrix adjust.
Identities = 94/103 (91%), Positives = 100/103 (97%)
Query: 1 MHKDPLFWHDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV 60
+HKDP+FW DNI+NFEENDFQILRVL+TILDTSSDPRALAVACFDLSQFIQYHPAGRVIV
Sbjct: 358 VHKDPMFWRDNISNFEENDFQILRVLITILDTSSDPRALAVACFDLSQFIQYHPAGRVIV 417
Query: 61 TDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQA 103
DLKAKERVMKLMNHEN EVTK++LLCIQRLFLGAKYASFLQA
Sbjct: 418 NDLKAKERVMKLMNHENAEVTKNSLLCIQRLFLGAKYASFLQA 460
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297737281|emb|CBI26482.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224124112|ref|XP_002319248.1| predicted protein [Populus trichocarpa] gi|222857624|gb|EEE95171.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388494890|gb|AFK35511.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224145903|ref|XP_002325805.1| predicted protein [Populus trichocarpa] gi|222862680|gb|EEF00187.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255558087|ref|XP_002520072.1| vacuolar ATP synthase subunit h, putative [Ricinus communis] gi|223540836|gb|EEF42396.1| vacuolar ATP synthase subunit h, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356498440|ref|XP_003518060.1| PREDICTED: V-type proton ATPase subunit H-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357518453|ref|XP_003629515.1| V-type proton ATPase subunit H [Medicago truncatula] gi|355523537|gb|AET03991.1| V-type proton ATPase subunit H [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217073296|gb|ACJ85007.1| unknown [Medicago truncatula] gi|388491592|gb|AFK33862.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356559428|ref|XP_003548001.1| PREDICTED: V-type proton ATPase subunit H-like isoform 1 [Glycine max] gi|356559430|ref|XP_003548002.1| PREDICTED: V-type proton ATPase subunit H-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| TAIR|locus:2083881 | 441 | AT3G42050 [Arabidopsis thalian | 1.0 | 0.233 | 0.844 | 7.3e-43 | |
| UNIPROTKB|G3V126 | 443 | ATP6V1H "ATPase, H+ transporti | 0.902 | 0.209 | 0.344 | 3.1e-15 | |
| UNIPROTKB|F1MZL6 | 465 | ATP6V1H "V-type proton ATPase | 0.902 | 0.2 | 0.344 | 3.5e-15 | |
| FB|FBgn0027779 | 468 | VhaSFD "Vacuolar H[+]-ATPase S | 0.902 | 0.198 | 0.354 | 3.6e-15 | |
| UNIPROTKB|F1MZL8 | 483 | ATP6V1H "V-type proton ATPase | 0.902 | 0.192 | 0.344 | 3.9e-15 | |
| UNIPROTKB|O46563 | 483 | ATP6V1H "V-type proton ATPase | 0.902 | 0.192 | 0.344 | 3.9e-15 | |
| UNIPROTKB|E2RHZ8 | 483 | ATP6V1H "Uncharacterized prote | 0.902 | 0.192 | 0.344 | 3.9e-15 | |
| UNIPROTKB|Q9UI12 | 483 | ATP6V1H "V-type proton ATPase | 0.902 | 0.192 | 0.344 | 3.9e-15 | |
| UNIPROTKB|Q9TVC1 | 483 | ATP6V1H "V-type proton ATPase | 0.902 | 0.192 | 0.344 | 3.9e-15 | |
| MGI|MGI:1914864 | 483 | Atp6v1h "ATPase, H+ transporti | 0.902 | 0.192 | 0.344 | 3.9e-15 |
| TAIR|locus:2083881 AT3G42050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 453 (164.5 bits), Expect = 7.3e-43, P = 7.3e-43
Identities = 87/103 (84%), Positives = 95/103 (92%)
Query: 1 MHKDPLFWHDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV 60
MHK+ FW +N+T FEENDFQILRVLLTILDTSSDPR+LAVACFD+SQFIQYH AGRVIV
Sbjct: 339 MHKETNFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAVACFDISQFIQYHAAGRVIV 398
Query: 61 TDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQA 103
DLKAKERVMKL+NHEN EVTK+A+LCIQRL LGAKYASFLQA
Sbjct: 399 ADLKAKERVMKLINHENAEVTKNAILCIQRLLLGAKYASFLQA 441
|
|
| UNIPROTKB|G3V126 ATP6V1H "ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, isoform CRA_c" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MZL6 ATP6V1H "V-type proton ATPase subunit H" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0027779 VhaSFD "Vacuolar H[+]-ATPase SFD subunit" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MZL8 ATP6V1H "V-type proton ATPase subunit H" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O46563 ATP6V1H "V-type proton ATPase subunit H" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RHZ8 ATP6V1H "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UI12 ATP6V1H "V-type proton ATPase subunit H" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9TVC1 ATP6V1H "V-type proton ATPase subunit H" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914864 Atp6v1h "ATPase, H+ transporting, lysosomal V1 subunit H" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| pfam11698 | 119 | pfam11698, V-ATPase_H_C, V-ATPase subunit H | 6e-43 | |
| cd00256 | 429 | cd00256, VATPase_H, VATPase_H, regulatory vacuolar | 2e-42 | |
| COG5231 | 432 | COG5231, VMA13, Vacuolar H+-ATPase V1 sector, subu | 1e-16 |
| >gnl|CDD|152134 pfam11698, V-ATPase_H_C, V-ATPase subunit H | Back alignment and domain information |
|---|
Score = 135 bits (343), Expect = 6e-43
Identities = 42/93 (45%), Positives = 63/93 (67%)
Query: 1 MHKDPLFWHDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV 60
+H FW +N FEEN++++L+ L IL+TS DP LAVAC D+ +F++ +P G+ I+
Sbjct: 23 VHTSEKFWKENAMKFEENNYELLKKLAKILETSDDPLTLAVACNDIGEFVRLYPEGKNIL 82
Query: 61 TDLKAKERVMKLMNHENTEVTKSALLCIQRLFL 93
L K RVM+LM+HE+ EV ALL +Q+L +
Sbjct: 83 EKLGVKARVMELMSHEDPEVRYEALLAVQKLMV 115
|
The yeast Saccharomyces cerevisiae vacuolar H+-ATPase (V-ATPase) is a multisubunit complex responsible for acidifying organelles. It functions as an ATP dependent proton pump that transports protons across a lipid bilayer. This domain corresponds to the C terminal domain of the H subunit of V-ATPase. The N-terminal domain is required for the activation of the complex whereas the C-terminal domain is required for coupling ATP hydrolysis to proton translocation. Length = 119 |
| >gnl|CDD|238159 cd00256, VATPase_H, VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >gnl|CDD|227556 COG5231, VMA13, Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| PF11698 | 119 | V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 | 100.0 | |
| cd00256 | 429 | VATPase_H VATPase_H, regulatory vacuolar ATP synth | 100.0 | |
| KOG2759 | 442 | consensus Vacuolar H+-ATPase V1 sector, subunit H | 100.0 | |
| COG5231 | 432 | VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene | 99.97 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 97.49 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 97.15 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 97.14 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 96.85 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 96.69 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 96.34 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 95.8 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 95.71 | |
| PF07539 | 141 | DRIM: Down-regulated in metastasis; InterPro: IPR0 | 93.96 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 93.78 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 93.14 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 93.12 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 93.06 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 92.3 | |
| PF09450 | 106 | DUF2019: Domain of unknown function (DUF2019); Int | 92.26 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 92.08 | |
| KOG1048 | 717 | consensus Neural adherens junction protein Plakoph | 91.91 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 91.59 | |
| PRK09687 | 280 | putative lyase; Provisional | 88.92 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 86.9 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 86.85 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 85.7 | |
| PF08167 | 165 | RIX1: rRNA processing/ribosome biogenesis | 85.31 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 84.41 | |
| PF02084 | 238 | Bindin: Bindin; InterPro: IPR000775 Bindin, the ma | 83.17 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 83.1 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 82.89 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 80.54 | |
| cd00183 | 76 | TFIIS_I N-terminal domain (domain I) of transcript | 80.52 | |
| PF11935 | 239 | DUF3453: Domain of unknown function (DUF3453); Int | 80.49 |
| >PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-51 Score=290.89 Aligned_cols=95 Identities=49% Similarity=0.889 Sum_probs=89.9
Q ss_pred CCCChhHHHHhHHhhhhccHHHHHHHHHHhccCCCcceeehhcchhHHHHHHccchhHHHHhhChHHHHHhhhcCCCHHh
Q 034106 1 MHKDPLFWHDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEV 80 (103)
Q Consensus 1 ~H~se~FW~ENa~kf~e~~~~llk~L~~lL~~s~d~~~laVAc~Digefvr~~p~gr~i~~~lg~K~~vM~Lm~h~d~eV 80 (103)
||+||+||+||+.||+|++|+++|+|+++|++|+||+++||||||||+|||+||+||++++++|+|++||+||+|+||+|
T Consensus 23 ~H~se~FW~ENa~kf~~~~~~llk~L~~lL~~s~d~~~laVac~Dig~~vr~~p~gr~ii~~lg~K~~vM~Lm~h~d~eV 102 (119)
T PF11698_consen 23 VHKSEKFWRENADKFEENNFELLKKLIKLLDKSDDPTTLAVACHDIGEFVRHYPNGRNIIEKLGAKERVMELMNHEDPEV 102 (119)
T ss_dssp GGG-HHHHHHHSGGGSSGGGHHHHHHHHHH-SHHHHHHHHHHHHHHHHHHHH-GGGHHHHHHHSHHHHHHHHTS-SSHHH
T ss_pred CCCCccHHHHHHHHHHHcccHHHHHHHHHHccCCCcceeehhhcchHHHHHHChhHHHHHHhcChHHHHHHHhcCCCHHH
Confidence 69999999999999999999999999999998999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhcch
Q 034106 81 TKSALLCIQRLFLGA 95 (103)
Q Consensus 81 r~eAL~avQklm~~~ 95 (103)
|||||+|+|++|+++
T Consensus 103 r~eAL~avQklm~~~ 117 (119)
T PF11698_consen 103 RYEALLAVQKLMVNN 117 (119)
T ss_dssp HHHHHHHHHHHHHHS
T ss_pred HHHHHHHHHHHHHhc
Confidence 999999999999988
|
ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include: F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins []. This entry represents the C-terminal domain of subunit H (also known as Vma13p) found in the V1 complex of V-ATPases. This subunit has a regulatory function, being responsible for activating ATPase activity and coupling ATPase activity to proton flow []. The yeast enzyme contains five motifs similar to the HEAT or Armadillo repeats seen in the importins, and can be divided into two distinct domains: a large N-terminal domain consisting of stacked alpha helices, and a smaller C-terminal alpha-helical domain with a similar superhelical topology to an armadillo repeat []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0015991 ATP hydrolysis coupled proton transport, 0000221 vacuolar proton-transporting V-type ATPase, V1 domain; PDB: 1HO8_A. |
| >cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07539 DRIM: Down-regulated in metastasis; InterPro: IPR011430 These eukaryotic proteins include DRIM (Down-Regulated In Metastasis) (O75691 from SWISSPROT), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells [] | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF09450 DUF2019: Domain of unknown function (DUF2019); InterPro: IPR018568 Protein of unknown function found in bacteria | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PF08167 RIX1: rRNA processing/ribosome biogenesis | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF02084 Bindin: Bindin; InterPro: IPR000775 Bindin, the major protein component of the acrosome granule of sea urchin sperm, mediates species-specific adhesion of sperm to the egg surface during fertilisation [, ] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >cd00183 TFIIS_I N-terminal domain (domain I) of transcription elongation factor S-II (TFIIS); similar to a domain found in elongin A and CRSP70; likely to be involved in transcription; domain I from TFIIS interacts with RNA polymerase II holoenzyme | Back alignment and domain information |
|---|
| >PF11935 DUF3453: Domain of unknown function (DUF3453); InterPro: IPR021850 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 103 | ||||
| 1ho8_A | 480 | Crystal Structure Of The Regulatory Subunit H Of Th | 8e-06 |
| >pdb|1HO8|A Chain A, Crystal Structure Of The Regulatory Subunit H Of The V-Type Atpase Of Saccharomyces Cerevisiae Length = 480 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| 1ho8_A | 480 | Vacuolar ATP synthase subunit H; heat repeat, hydr | 3e-34 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 1e-04 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Length = 480 | Back alignment and structure |
|---|
Score = 121 bits (305), Expect = 3e-34
Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 9/100 (9%)
Query: 1 MHKDPLFWHDNITNFEENDFQILRVLLTIL---------DTSSDPRALAVACFDLSQFIQ 51
H D FW DNI F++++++I R L+ +L + + + VA D++ ++
Sbjct: 375 PHVDNGFWSDNIDEFKKDNYKIFRQLIELLQAKVRNGDVNAKQEKIIIQVALNDITHVVE 434
Query: 52 YHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRL 91
P ++ K +M+L+NH ++ V AL Q +
Sbjct: 435 LLPESIDVLDKTGGKADIMELLNHSDSRVKYEALKATQAI 474
|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| 1ho8_A | 480 | Vacuolar ATP synthase subunit H; heat repeat, hydr | 100.0 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 98.05 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 97.79 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 97.67 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 97.67 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 97.6 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 97.51 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 97.39 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 97.32 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 97.23 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 97.1 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 97.08 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 97.08 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 97.03 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 96.91 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 96.81 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 96.67 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 96.63 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 96.62 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 96.51 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 96.49 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 96.44 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 96.38 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 96.35 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 96.34 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 96.18 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 96.15 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 95.85 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 95.77 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 95.66 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 94.96 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 94.9 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 94.67 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 93.22 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 93.18 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 93.05 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 92.52 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 92.28 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 92.18 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 91.99 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 91.93 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 91.83 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 91.82 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 91.82 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 91.81 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 91.76 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 91.03 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 90.92 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 90.8 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 90.31 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 89.66 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 89.51 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 89.44 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 89.09 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 88.71 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 88.61 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 88.51 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 88.37 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 87.27 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 87.19 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 86.83 | |
| 2i9c_A | 123 | Hypothetical protein RPA1889; structural genomics, | 85.18 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 85.07 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 84.58 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 83.91 | |
| 2ibj_A | 88 | Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif | 83.13 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 82.17 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 81.41 |
| >1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 | Back alignment and structure |
|---|
Probab=100.00 E-value=5.8e-45 Score=302.92 Aligned_cols=95 Identities=26% Similarity=0.489 Sum_probs=92.6
Q ss_pred CCCChhHHHHhHHhhhhccHHHHHHHHHHhcc---------CCCcceeehhcchhHHHHHHccchhHHHHhhChHHHHHh
Q 034106 1 MHKDPLFWHDNITNFEENDFQILRVLLTILDT---------SSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMK 71 (103)
Q Consensus 1 ~H~se~FW~ENa~kf~e~~~~llk~L~~lL~~---------s~d~~~laVAc~Digefvr~~p~gr~i~~~lg~K~~vM~ 71 (103)
||+||+||+||+.||+||||+++|+|++||++ |+||+++||||||||||||+||+||.+++++|||++||+
T Consensus 375 ~H~se~FW~ENa~kf~e~~~~llk~L~~iL~~~~~~~~~~~s~d~~~laVAc~Digefvr~~P~gr~i~~~lg~K~~VM~ 454 (480)
T 1ho8_A 375 PHVDNGFWSDNIDEFKKDNYKIFRQLIELLQAKVRNGDVNAKQEKIIIQVALNDITHVVELLPESIDVLDKTGGKADIME 454 (480)
T ss_dssp GGGCHHHHHHHSGGGSSGGGHHHHHHHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHHHCTTHHHHHHHHSHHHHHHH
T ss_pred CccchhHHHHHHHHHHhcchHHHHHHHHHHhhhccccccccCCCcceEEeecccHHHHHHHCcchhHHHHHcCcHHHHHH
Confidence 69999999999999999999999999999974 569999999999999999999999999999999999999
Q ss_pred hhcCCCHHhHHHHHHHHHHHhcch
Q 034106 72 LMNHENTEVTKSALLCIQRLFLGA 95 (103)
Q Consensus 72 Lm~h~d~eVr~eAL~avQklm~~~ 95 (103)
||+|+||+||||||+|+||+|+++
T Consensus 455 Lm~h~d~~Vr~~AL~avQklm~~~ 478 (480)
T 1ho8_A 455 LLNHSDSRVKYEALKATQAIIGYT 478 (480)
T ss_dssp HTSCSSHHHHHHHHHHHHHHHHHS
T ss_pred HhcCCCHHHHHHHHHHHHHHHHhc
Confidence 999999999999999999999998
|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2i9c_A Hypothetical protein RPA1889; structural genomics, SAD, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.00A {Rhodopseudomonas palustris} SCOP: a.118.1.25 | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 103 | ||||
| d1ho8a_ | 477 | a.118.1.9 (A:) Regulatory subunit H of the V-type | 1e-37 |
| >d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 477 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Regulatory subunit H of the V-type ATPase domain: Regulatory subunit H of the V-type ATPase species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 129 bits (325), Expect = 1e-37
Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 9/100 (9%)
Query: 1 MHKDPLFWHDNITNFEENDFQILRVLLTIL---------DTSSDPRALAVACFDLSQFIQ 51
H D FW DNI F++++++I R L+ +L + + + VA D++ ++
Sbjct: 372 PHVDNGFWSDNIDEFKKDNYKIFRQLIELLQAKVRNGDVNAKQEKIIIQVALNDITHVVE 431
Query: 52 YHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRL 91
P ++ K +M+L+NH ++ V AL Q +
Sbjct: 432 LLPESIDVLDKTGGKADIMELLNHSDSRVKYEALKATQAI 471
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| d1ho8a_ | 477 | Regulatory subunit H of the V-type ATPase {Baker's | 100.0 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 97.45 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 97.25 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 97.04 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 96.96 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 96.94 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 96.6 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 95.61 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 95.61 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 95.52 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 95.23 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 94.62 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 93.63 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 92.12 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 92.12 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 91.63 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 91.49 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 91.38 | |
| d1cxya_ | 81 | Cytochrome b558 {Ectothiorhodospira vacuolata [Tax | 88.24 | |
| d1soxa2 | 91 | Sulfite oxidase, N-terminal domain {Chicken (Gallu | 87.08 | |
| d1mj4a_ | 80 | Sulfite oxidase, N-terminal domain {Human (Homo sa | 86.3 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 86.13 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 84.73 | |
| d1euea_ | 86 | Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 101 | 84.71 | |
| d1cyoa_ | 88 | Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} | 83.89 | |
| d1kbia2 | 97 | Flavocytochrome b2, N-terminal domain {Baker's yea | 83.11 | |
| d2i9ca1 | 121 | Hypothetical protein RPA1889 {Rhodopseudomonas pal | 82.89 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 82.28 |
| >d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Regulatory subunit H of the V-type ATPase domain: Regulatory subunit H of the V-type ATPase species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=1.1e-45 Score=305.21 Aligned_cols=95 Identities=26% Similarity=0.489 Sum_probs=92.6
Q ss_pred CCCChhHHHHhHHhhhhccHHHHHHHHHHhc---------cCCCcceeehhcchhHHHHHHccchhHHHHhhChHHHHHh
Q 034106 1 MHKDPLFWHDNITNFEENDFQILRVLLTILD---------TSSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMK 71 (103)
Q Consensus 1 ~H~se~FW~ENa~kf~e~~~~llk~L~~lL~---------~s~d~~~laVAc~Digefvr~~p~gr~i~~~lg~K~~vM~ 71 (103)
||+||+||+||+.||+|+||+++|+|++||+ +|+||+++||||||||||||+||+||.+++++|+|++||+
T Consensus 372 ~H~se~FW~EN~~kf~e~~~~llk~L~~lL~~~~~~~~~~~s~D~~~lAVAc~DiGefvr~~P~gr~il~~lg~K~~vM~ 451 (477)
T d1ho8a_ 372 PHVDNGFWSDNIDEFKKDNYKIFRQLIELLQAKVRNGDVNAKQEKIIIQVALNDITHVVELLPESIDVLDKTGGKADIME 451 (477)
T ss_dssp GGGCHHHHHHHSGGGSSGGGHHHHHHHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHHHCTTHHHHHHHHSHHHHHHH
T ss_pred CcCChhHHHHHHHhhcccchHHHHHHHHHHhhcccccccccCCCcceeehhhhhHHHHHHHCcchhHHHHHcCcHHHHHH
Confidence 6999999999999999999999999999996 3679999999999999999999999999999999999999
Q ss_pred hhcCCCHHhHHHHHHHHHHHhcch
Q 034106 72 LMNHENTEVTKSALLCIQRLFLGA 95 (103)
Q Consensus 72 Lm~h~d~eVr~eAL~avQklm~~~ 95 (103)
||+|+||+||||||+|+||+|+||
T Consensus 452 Lm~h~d~~Vr~eAL~avQklm~~n 475 (477)
T d1ho8a_ 452 LLNHSDSRVKYEALKATQAIIGYT 475 (477)
T ss_dssp HTSCSSHHHHHHHHHHHHHHHHHS
T ss_pred HhcCCCHHHHHHHHHHHHHHHHhc
Confidence 999999999999999999999998
|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} | Back information, alignment and structure |
|---|
| >d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i9ca1 a.118.1.25 (A:3-123) Hypothetical protein RPA1889 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|